Criminal Organization

Criminal Organization

Another video by Greg which I put on my blog not because I am promoting any sort of trading but because I believe he has his finger on the pulse and I enjoy his style.  He says that the Middle Class is being exterminated and calls the Fed the biggest criminal organization in the world (lolz). He is correct on both counts.    This is the biggest robbery (transfer of wealth) in history.

Economy Contracting Rapidly, Inflation NOT TRANSITORY, Stock Market RIPS HIGHER. Mannarino (15 min)

To this I add the latest from Brendon:

Brendon O’Connell

Thanks Luke, yeh, wow…out of left field😄

CCP very soon.

I’m sure there will be alot to it. But the US is not about to dump dollars just yet. Cash will be here a while. And the SWIFF does just fine, though Klaus wants his Swiss Star Trek crypto as he awaits the space ship arrival.



As long as we’re not in enclosed Smart Cities, we’ll be needing a little cash. Power going out causes problems. I guess they’ll have an answer for that, specialized trackable notes.

Anyway, we’re on the way. Maybe we’ll all get a break from Covid but me thinks it has yet to bear the full fruits of a fully divided nation in the US.

Australia continues to play a strange game. Sweden laughs at everyone.

I expect an Australian first any day…the first political assassination on Oz paradise soil. They are really pushing their luck in Victoria at least and why that is…I do not know. Maybe they’re scared of Chabad Lubavitch who congregate there? 😄

My home state of Western Australia walk around in relative freedom due to isolation. The idiot Labor/Democrat party leadership are such overt cretinous morons you have absolutely no idea and West Australian Sand Gropers are…ON the whole…lapping every bit if the narrative up and putting sour cream and chives on top. F them…let them clot.

I await the hand over of Taiwan.

And the Chinese miracle?

Brendon comments:


Paltry cases...if the lockdown spreads...does it show Evergrande economic virus far more dangerous?

TMU states China just lost %25 of its GDP. That's a huge hit. No more building. Will China get a massive lock down? Government buys those ghost cities, 30c on the dollar...max...and become the Great Comrade Smart City Landlord?

Will Canada, US, Mexico, Central and South America take up the infrastructure slack on giant buildings g projects? Rail, road and Smart City development?

Whatever happens, this November is going to be very interesting.

If Xi doesn't get Taiwan handed to him, perhaps there is hope of a gentle let down.

Xi will be busy handling his greatest enemy - 1.4 billion Chinese people who want food, shelter, work and hope.

Our World Isn’t Ready For This (Jeff Nyquist 2/2)

Our World Isn’t Ready For This (Jeff Nyquist 2/2)

Highly Recommended

This is the second half of a great interview highly recommended.  The full version (1 hr 11 min) can be found here (https://youtu.be/LSfZYLMgk6o)

Part 2 (43 min)

 

Here is what the main stream media (CNBC) is saying.  Note how they even include wokeism in the report.   Hegelian Dialectic. Create the problem, then offer the solution. The solution is you being permanently locked down, rationed, tracked and vaccinated.  Everything will go on the blockchain….including food.

You will obey citizen……or you will not eat.

Why Food Is Getting More Expensive In The U.S. (15 mins)

CJD, Amyloid and K26R

CJD, Amyloid and K26R

The latest Kevin McCairn stream edited and split into three videos.  The first is a short video expanding on the topic from the previous video:  Global Prion Disease Treatment Market – Industry Trends and Forecast to 2028

Mad cows or crazy people? (5 mins)

Amyloid plaques (1 hour)

Resources

Presence of a SARS-CoV-2 Protein Enhances Amyloid Formation of Serum Amyloid A

GISAID Initiative

NCBI Sars CoV-2 Resources

Second entry looking for E-protein (envelope protein)

=====================
/product=”envelope protein”
/protein_id=”UBC57849.1″
/translation=”MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCC
NIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV”
=====================
Paste sequence in PLAAC:

MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV

PLAAC: Prion-Like Amino Acid Composition

Another paper on amyloid formation:

Interactions between SARS-CoV-2 N-protein and α-synuclein accelerate amyloid formation

 

ACE2 and the JEW: K26R to bind or not to bind that is the question? (15 min)

The following paper was published in Nature on 12 April 2021: Human ACE2 receptor polymorphism and altered susceptibility to SARS-CoV-2

"Among the variants tested, ACE2 K26R, consistent with its increased affinity for S-RBD observed in the biochemical assay, was the most effective (Ki 30 nM; ~33 fold greater than WT) in blocking viral entry (Fig. 5 and Table 1)".

"We also show that another ACE2 residue, K26, plays an important role in controlling the susceptibility to viral infections via a similar mechanism. Our structural analysis has suggested that K26R mutation will weaken coordination of the N90-linked glycan presumably interfering with its ability to shield the host from the viral infection. Our biochemical binding assays confirmed the predicted increased affinity for K26R ACE2 for S-protein. In fact, K26R ACE2 was the most effective among mutants tested for their ability to enhance viral entry, suggesting that this frequent polymorphism, very likely increases susceptibility to SARS-CoV-2 (Fig. 5 and Table 1)".

The above article in Nature says that K26R blocks the virus….in other words Ashkenazi Jews would be the most susceptible to covid. This goes completely contrary articles which state that the Jews are the least susceptible to covid such as this one: ACE2 coding variants in different populations and their potential impact on SARS-CoV-2 binding affinity. Look at the bar chart in the tweet below at the binding energy of K26R.

We also have another study that states;

Amish (AMI) and Ashkenazi Jewish (ASJ) populations do not appear to carry such variants in ACE2 coding regions (Fig. 1b). 
New insights into genetic susceptibility of COVID-19: an ACE2 and TMPRSS2 polymorphism analysis

So who is correct? A far as I am concerned anything published in Nature is suspect. The Indian author Somasekar Seshagiri works for Modmab Therapeutics Corporation is located in Foster City  California and  received a Coronavirus-related PPP loan from the SBA of $124,434.00 in April, 2020. Moreover, he went to the University of Georgia (in Athens, GA, US) where the Institute of Bioinformatics (founded 2002) with links to CDC has as director Jessica Kissinger.   Now Kissinger is an unusual name.  I am sure I heard it somewhere else (lolz).  Is she related to Henry?  Henry and his brother both have children and grand children. His mother (Mrs Kissinger) who died age 97 (Henry is 96 now)  was survived by two sons, as well as six grandchildren and six great-grandchildren.

These authors contributed equally: Kushal Suryamohan, Devan Diwanji, Eric W. Stawiski.
Cardiovascular Research Institute, University of California San Francisco.  The article they have just released was based on one that was written nearly exactly a year earlier (April 10, 2020). From memory this was about the time that the NYT posted an web article showing the complete genome sequence including 3D models of all the proteins.  The one released a year earlier Human ACE2 receptor polymorphisms predict SARS-CoV-2 susceptibility says something similar:

"....and thereby potentially alter host susceptibility. In particular, human ACE2 variants S19P, I21V, E23K, K26R, T27A, N64K, T92I, Q102P and H378R are predicted to increase susceptibility". 

It has many more authors (who seem to be have fallen away from this version): Eric W. Stawiski, Devan Diwanji, Kushal Suryamohan, Ravi Gupta, Frederic A. Fellouse, J. Fah Sathirapongsasuti, Jiang Liu, Ying-Ping Jiang, Aakrosh Ratan, Monika Mis, Devi Santhosh, Sneha Somasekar, Sangeetha Mohan, Sameer Phalke, Boney Kuriakose, Aju Antony, Jagath R. Junutula, Stephan C. Schuster, Natalia Jura, Somasekar Seshagiri.

This was a comment that I found under the article (the first one):

Comment: Ivan Shabalin

 
The paper describes an interesting idea, but the structural analysis and the predictions of the effects of the mutations are unsubstantiated and should be significantly revised.

For example, the presented analysis of the first mutation - K26R - has the following red flags:

- Figure 3b shows sugar labelled as "mannose", whereas the first sugar in glicosilated mammalian proteins should be N-acetylglucosamine (GlcNAc, or NAG), as it is in the crystal structures used for the analysis.

- The claim "We predict that K26R would abrogate stabilizing polar
contacts with N90, impairing coordination of the glycan (Figure 3b) and lead to an increase in the affinity of the virus to the ACE2 receptor" seems completely baseless. First, K and R are positively charged residues with similar lengths; I'm not convinced this mutation would necessarily abrogate the contact with NAG. Second, why would R form the predicted interaction with D-30? why not with Glu23, which is closer? Third, the following claim is very questionable "At the same time, R26 is now primed to establish backbone and side chain interactions with ACE2 D30 which then is poised to build a salt-bridge with CoV-2 RBD K417". In what way the proposed interaction R26-D30 would make D30 more prone to forming the salt bridge with K417? If anything, it would only decrease the strength of the bridge be being a "charge competitor". And, the salt bridge D30-K417 already exists in one of the structures they analyzed (6LZG).

Similarly, there are issues in the analysis of the second mutation:
- "The T27A mutant (Figure 3c) removes side chain-backbone and backbone-backbone interactions between T27 and E30 likely increasing the local dynamics of helix α1". First, there is a typo - it is E23. Second, the stability of a helix is mostly set by the C=O...N bonds between main-chain atoms, and the elimination of a side chain H-bond is unlikely to have a significant effect on the shape of the helix. Then, "This would allow the N-terminus of α1 to bend slightly and accommodate the unique CoV-2 RBD receptor binding-ridge loop that more intimately contacts ACE2 compared to its SARS-CoV counterpart" sounds very much unsubstantiated. To draw these conclusiong, MD simulations might need to be not perfomed.

Clearly, the analysis of other mutations is also questionable.

I believe that the Nature article is involved in a  cover up.

Ashkenazi Jews and the Amish people are related and they carry a similar polymorphism not just on ACE2 but other genes.   Moreover,  Jews are less susceptible to respiratory disease. The paragraph below  is from the blog article with the title:  Bio-war race targeting (McCairn1).

Ethnic Targeting

A number of questions come to my mind. In the paper discussed by Kevin the Jews and the Amish have a similar genetic polymorphism that protects them from Covid.  This means that  the Amish and the Jews are related. The history of the Amish church began with a schism in Switzerland within a group of Swiss and Alsatian Mennonite Anabaptists in 1693 led by Jakob Ammann. Those who followed Ammann became known as Amish. … In the early 18th century, many Amish and Mennonites immigrated to Pennsylvania for a variety of reasons. Not only do the Amish share a polymorphism with Ashkenazi Jews that makes them resistant to covid they share genetic loci for myopia (Fine-mapping of candidate region in Amish and Ashkenazi families confirms linkage of refractive error to a QTL on 1p34-p36). Anabaptists and Jews have had interactions for several centuries, since the origins of Anabaptism in the Radical Reformation in early modern Europe. Due to the insularity of many Anabaptist and Jewish communities, Anabaptist–Jewish relations have historically been limited but there are notable examples of interactions between Anabaptists and Jews. Due to some similarities in dress, culture, and language, Amish and Mennonite communities in particular have often been compared and contrasted to Hasidic Jewish communities (Wikipedia).The Mennonite Metzler family, tracing their lineage of descent through Valentine Metzler, a German immigrant who arrived in Lancaster County with his father Jacob in 1738, has close Y-DNA matches to Jewish families such as Kronik (in Belarus), Cohen and Langer (in Ukraine) and Friedman and Wengrowski (in Poland). [Anabaptisthistorians].  So, that solves that mystery. At some stage Ashkenazi Jews and Annabaptists must have interbred in Europe.

Not just  the study cited by Kevin but this one also presents a similar finding:

Here, we have analyzed the genetic markers of the TMPRSS2 gene and the differences in their alternative allele frequencies (AFs) among populations to identify possible susceptibility loci to COVID-19 and to correlate them with disease epidemiology. *AF= alternative allele frequencies (AFs). Regarding the non-synonymous pathogenic variants, we observed the highest AF among the Ashkenazi Jewish (ASJ) population (Figure 1A), while the Finnish (FIN) showed the highest AF among European subpopulations (Figure S2A). 
Genetic Analysis of the Coronavirus SARS-CoV-2 Host Protease TMPRSS2 in Different Populations

And this article from 2009:

DENVER — Researchers at National Jewish Health and the University of Colorado Denver have discovered a gene that is associated with improved survival among patients with acute lung injury. Acute lung injury (ALI) is often caused by a respiratory infection and results in low oxygen levels in the blood, and fluid in the lungs. It is one of the most vexing problems for intensive care units, afflicting almost 200,000 people in the United States each year, and killing 40 percent of them. https://www.nationaljewish.org/about/news/press-releases/2009/acute-lung-injury

And this paper:

The K26R (rs4646116) variant is an ACE2 variant that facilitates the binding of the S-glycoprotein effective in binding the coronavirus to the host cell and increases the susceptibility to the virus. The K26R variant, which reduces virus binding to the ACE2 receptor, has been found to be more concentrated in the Jewish population (1.2%) and, in contrast, the Asian population has the lowest allele frequency for the single nucleotide variant encoding K26R*

* Al-Mulla F, Mohammad A, Madhoun AA, Haddad D, Ali H, Eaaswarkhanth M, et al. A comprehensive germline variant and expression analyses of ACE2, TMPRSS2 and SARS-CoV-2 activator FURIN genes from the Middle East: Combating SARS-CoV-2 with precision medicine. bioRxiv 2020
Effects of Human Genetic Factors (Ethnicity and Race) on Clinical Severity of SARS-CoV-2 (COVID-19)Journal of Experimental and Basic Medical Sciences 2020;1(3):147-158

Geopolitics and Propaganda

Geopolitics and Propaganda

Nothing is straightforward or what it seems.  Is China getting ready for war?  Probably…but a  geopolitical game is being played.   China was deeply involved in the making of the Covid bioweapon but so were many international institutions. So was the USA.  Their first plan was to blame natural origins and because this is failing their fall back plan is to blame China. 

The one thing they don’t want is for you to look at the supra-national institutions and their links to the banking cabal and Israel.  Do not look at the WEF or the WHO or Bill Gates or Israel, or the Rothschild or the Epsteinization of science or the malfeasance and corruption.    It was a bat…..sorry, I mean…it was China.

The problem is that both sides of the equation…..although they are fighting each other, really  have the same enemy.  That enemy is you.   They want you locked up in your SMART city and controlled.China and the West want the same thing.   The argument is not about democracy or human liberty….it is about who is going to rule the NWO.

People have to think outside the box.  This is no longer about “countries” and “nation states” but about who gets to rule the world.  There are very powerful supra-national entities and corporations involved.  Nation States are so “last century” (lolz) who needs the Westphalian system?  That is so yesterday.  We are building the tower of Babel (don’t-cha know?) and our new language is “science”.  This is the era of techno-fascism. It is no longer mother knows best,  but….the man in the white coat told me so it must be true.

We know that the virus was circulating in the USA early than they are letting on but it was also circulating in China in October.   What happened?   Did it accidentally leak from a lab in the USA or China?    Was it then deliberately planted or salted in China as part of a cover up?

We will probably never know the full back-story but we know this much; it was made in a lab and it was either leaked or released or perhaps both.  We know that supranational globalist institutes are involved. We know that banking, finance and media linked to a Jewish cabal are involved.  We know that they have been planning something like this for over a century. 

 

War with China: Are we closer than we think? | Under Investigation (42 mins)

India is the one to watch in all of this as they provide the regional counter balance. A lot of Indians are based and down to earth like General Bakshi.

  India’s master-plan to counter China (14 Mins)

 

Increasing Activity

Increasing Activity

A new vent has appeared.   Is that good or bad?

La Palma: Eruptions continue, earthquakes prompt further evacuations https://bit.ly/39soDPZ La Palma volcano (Canary Islands (Spain)) activity update https://bit.ly/3kvNJE0 ERUPTION AT 20210919/1410Z INTENSE LAVA FOUTAINS ONGOING to 10000 ft (3000 m) https://bit.ly/3EFsibz Cumbre Vieja volcano eruption, La Palma: first lava samples https://bit.ly/3CDbuQE La Palma Quakes vs Depth https://volcanodiscovery.de/fileadmin… 🔴ERUPCIÓN VOLCÁNICA del CUMBRE VIEJA en LA PALMA –10:20 (22/09-2021) https://www.youtube.com/watch?v=HN27r… Magnitude 5.9 earthquake strikes near Melbourne, Australia https://cnn.it/3EFsIPb

La Palma Volcano (Canary Islands (Spain)) Activity Update – Lava Fountains To 10,000ft (3 min)

9/21/2021 — Major Seismic Unrest Worldwide — La Palma Volcano to Australia M6.0 near Melbourne (1:56)

I always thought the Australia was pretty stable on it’s own plate.  However, as Dutch says the energy has flowed around the plate and then transfers to Eurasia but we always tend to get a push from the North West which travels diagonally across central Australia.  The 6.0 in Victoria is the biggest quake in recorded (Australian) history.  It is the coastal craton and their are a number of volcanic fields there.  Coverage of Australia begins at 4:08.  The USGS are saying that La Palma is nothing to worry about.  Perhaps they are right….but they have been caught lying multiple times.  We shall wait and see and keep a close eye on it.

 

Solar Watch, Earthquakes, Intelligent Design Universe | S0 News Sep.22.2021 (4 min)

Ben is correct.  The Universe is a sign of God’s magnificent handiwork.  Nothing is random or coincidence.  Everything lives and moves and has its being in him…..as we are about to find out.

Today’s Featured Links:

NASA Roman: https://hubblesite.org/contents/news-… 3D Molecular Clouds: https://arxiv.org/pdf/2109.09765.pdf Intelligent Design: https://arxiv.org/pdf/2109.10241.pdf

Veritas James O’Keefe

Veritas James O’Keefe

I have no doubt that the whistleblower report itself is genuine but it has  been stage managed and scripted for impact.  With the connections that O’Keefe has it is no doubt part of IIA operations. The original Veritas video was debunked by Kevin (see the article: Zombies, D.R.A.S.T.I.C and Prions watch the video at 34 minutes).

The take away is that the information is real but O’Keefe et al have a job to do.  They are appealing to Trump supporters (and Christians) and trying to accelerate the break-up of the United States.  The narrative is that decent gun loving Christians will go to places like Texas and progressive, lib tard commies will go to gay San Fran where they  can poo in the street.

They are selling a narrative and trying to get other whistleblowers to come forward by dangling a carrot (money).

James O’Keefe & HHS Insider Jodi O’Malley discuss #CovidVaxExposed Part 1 Facebook/Instagram Removal (10 mins)

SARS CoV-2 was Lab Made

SARS CoV-2 was Lab Made

VERY GOOD RECOMMENDED 43 min

This is a pretty good video by Chris from Peak Prosperity.  It summarizes what has happened so far and Chris explains about D.R.A.S.T.I.C. and basically points out what Dr Kevin McCairn already has done but he does it very clearly in a structured manner.

They have been exposed.  It was made in a lab and it was released on purpose. 

Episode 028

  • 00:00 – Intro
  • 00:49 – An Explosive Document Leak to DRASTIC
  • 01:58 – The Bombshell! Insertion of Furin Cleavage Sites to Enhance Pathogenicity
  • 08:07 – DRASTIC’s Opening Statement Part I
  • 11:58 – DRASTIC’s Opening Statement Part II
  • 14:50 – Key 2020 Moments in the Lab Leak Cover-Up
  • 20:24 – The Bombshell
  • 29:48 – Creation of Viruses Exactly Like the One That Causes COVID-19
  • 32:33 – The Smoking Gun
  • 39:38 – Conclusions for the DRASTIC Document Leak

Do you believe you deserve to know if the SARS-CoV-2 virus that has upended the world, and your life, for the past 20 months was made by humans? I know I deserve to know that, as does everyone. Well, the field of that battle just got a little bit clearer. A leaked document shows that in 2018 the EcoHealth alliance had pitched DARPA to fund a huge amount of work on bat coronaviruses including mixing and matching the most dangerous elements of them (so-called chimeric virus assemblies) as well as identifying and inserting the best human furin cleavage sites in them to increase pathogenicity. All of this work was to be done in collaboration with the Wuhan Institute of Virology up to and including playing a significant portion of “the bat lady’s” salary. DARPA declined to fund this work over obvious concerns. No matter, this same work was funded by the NIH, which also, for unknown reasons, by-passed the usual institutional oversight governing such dangerous work. So far the media is stone silent on this matter. We hope this video is allowed to stand on YouTube, as it is presenting facts and drawing some very obvious conclusions. However, it will also be embarrassing to certain layers of bureaucracy, so we all know the risks here. The emperor would very much like to continue believing he’s wearing a fine set of garments. We are in the final moments of that old narrative being contained. People are waking up. The good news is that you can always join our completely uncensored conversations by becoming a member at Peak Prosperity. Just click this link: https://mailchi.mp/peakprosperity.com… You can also take a stand against censorship and medical nihilism! Become a free subscriber to Peak Prosperity here https://www.peakprosperity.com/wp-log… OR better yet, become a full paying member for only $7 for your first month here: https://www.peakprosperity.com/produc…. Access to all of Chris’s content, live webinars twice a month, and much much more is available to our paying members. Part I Links: DRASTIC Files https://drasticresearch.files.wordpre… EcoHealth Alliance Website https://www.ecohealthalliance.org/ The Seeker (DRASTIC member) https://twitter.com/TheSeeker268/stat… Media poo-pooing lab leak theory in 2020 https://www.nytimes.com/2020/02/17/bu… https://www.cnn.com/2020/03/28/media/… https://www.npr.org/2020/04/22/841925… LANCET TASK FORCE https://static1.squarespace.com/stati… Proximal Origin of SARS-CoV-2 https://www.nature.com/articles/s4159… Baric-Shi paper 2015 https://www.ncbi.nlm.nih.gov/pmc/arti… No Close Relatives of SARS2 with cleavage sites http://chinaxiv.org/user/download.htm…

Zombies, D.R.A.S.T.I.C and Prions

Zombies, D.R.A.S.T.I.C and Prions

I simply do not have time to edit some of these videos. This one is five hours long and the next one has already streamed (lolz).    I have watched it in full and will place some time stamps below so that you can go to the relevant section.

The most important sections are the one on the article by D.R.A.S.T.I.C. that has unearthed more damning evidence. In fact, their research has been used by Sharri Markson (without any acknowledgement).  Also, the section on the increase of global prion disease (forecast) is truly frightening.  We are dealing with truly evil people.  Here follow rough time stamps.  Skip the first 34 minutes etc unless you want the memes and intro etc.

With all the new evidence…what do you think will happen?   You might think that nothing will happen but that is not true.  What will happen is that the Proximal Origins crew will produce more “scientific papers” in Nature and the Lancet. They will be given even larger grants to make sure “that it (natural spillover) never happens again”.  They will all get richer and more powerful. More pharma billionaires will be created. And you (and your kids) will get sicker and die. If you survive you will find yourself in permanent lockdown.

Running Order

See Below the video for Resources

Resources

 

Gigaohm Biological (21 Sept)

Gigaohm Biological (21 Sept)

Powerful

I just received information that someone I distantly know had  family members die from covid. Apparently  he is in the Iraqi community and a number of his acquaintances and family have caught covid and died.   They distrust the Government and they did not believe that the virus was dangerous.

Let me be clear. I have never said that the virus is not dangerous.  The virus is certainly dangerous especially for those who are obese, or suffering from co-morbidity.  It is also dangerous for the elderly.

However, the vaccine (transfection)  is also dangerous.   It allows vaccinated people to walk around with a high viral load.  In some cases it does reduce the symptoms of infection therefore it should be regarded as a treatment, albeit not a very good one.  The question remains…..what is the spike protein doing in the body (other than suppress covid symptoms)? We already have evidence that it can cross the blood-brain barrier.  So, long-term we will see a spike in neuro-degenerative diseases.

We only have hard choices.   There are no good choices.  They have put us in a position where we only have bad choices.    The vaccinated and unvaccinated bear no blame.  We are all in the same boat.  The ones to blame are the people who made and released a bioweapon and the ones who refuse alternative treatments.  We have very effective anti-viral treatments and other medicines and supplements that are very effective.  The government should be using those treatments and running a campaign on immune health.

Gigaohm Biological 21 Sept (2hrs 24 mins)