Gigaohm Biological (24 May)

Gigaohm Biological (24 May)

Not watched this yet but all signs are pointing towards amyloidosis.  Both Jessica and Walter have recently produced articles on amyloidosis and now J.C. is about to discuss it.  However, it was Dr Kevin McCairn who highlighted this at least  18 months ago.  Amyloidois, tauopathy and prionopathy can cause neurodegenerative diseases  either by the build up of protein or the misfolding of proteins.  This can cause various disease of the CNS or brain including dementia, Parkinson, CJD etc.

 

Gigaohm Biological High Resistance Low Noise Information Brief: Amyeloidosis and SARS CoV2 (1:25)

Long COVID and Prionopathy

Long COVID and Prionopathy

A nearly three hour stream from Dr Kevin McCairn on the sistuation in Ukraine and analysis of a number of papers highlighting the neurodegenerative aspect of covid and of the vaccines (transfections). This is the Boxcast version of the video.

Running Order and rough time slots

 

Long COVID/Prionopathy Latest & Ukraine ‘MOAR’ War! (2:44)

Aerosolized Prion Protein

Aerosolized Prion Protein

This is a replay and updating of the original lecture given by Dr Kevin McCairn from a year ago.  This stream is pure science and explains the damage that Sars-Cov-2 and the S-protein does.   The Prion threat and neuroptropic disease is very real.  We are dealing with monsters.

So this is a very good introduction to the brain science and origin of Covid 19.

Catecholamine Toxicity and CJD

Catecholamine Toxicity and CJD

This is a 7.5 hour stream with Dr Kevin McCairn doing live stream science from 4:13 onward looking at graphene and debunking the graphene narrative by looking at graphene in solution.  If graphene is present (and there could be) it is either an artifact of the manufacturing   process (contamination) or part of a delivery mechanism.  It is not self assembling nano-bots or hydras. This is “jihad science” done live so that the results can be seen and evaluated (and questioned).  The “creature” in the top left of the screen is possible contamination from the solvent or in the graphene sample. A sensationalist (like  Dr. Carrie Madej) would claim it was a hydra and that it felt like it was “looking at her”. (lolz) . Dr Botha would probably say the sample had self assembling nano-bots (air bubbles) and Stew Peters and Dr Jane Ruby would probably claim that salt crystals were electronic circuit micro chips. Then again Kaufmann would say it was an exosome “because viruses are not real”  and order a new Porsche and more hair extensions.  They are all charlatans and grifters.  They are either being paid or promoted by inteligence services/ pharma to confuse  and sow disinformation. Dr Kevin McCairn has ordered some new equipment including for sonic cleaning of microscope slides.  He is funded to do the work by the “raccoon community”.  We have lost a number of good people lately including Kev Baker and Luc  Montagnier Nobel Prize Winner and co-signatory of the ICC case but the fight continues.

At 2:57:48 my “antisemitic” meme is displayed and the good doctor almost gets the hiccups from laughing.  This is legitimate push-back at a corporate and media system financed and propagandized by Jewish media, Jewish pharma and Jewish banking.  A full 43% of the 1% are Jews and they want you to believe that they are victims while they  inject your children under  a twisted ideology of Jewish supremacy and Tikkun Olam (heal the world).  Their idea of healing the world is to get rid of white gentiles.  Do I believe all Jews are guilty of this mindset?  Most certainly not. Look at Israel, it has been used as a test lab by Pfizer.  However, a certain sub-set of Jews (Ashkenazi) have an advantageous polymorphism that makes them less vulnerable. Within that sub-set there is a minority with Polish-Russian roots who wield enormous power.  They are quite willing to sacrifice their own people for “the greater good” and they have actively encouraged and  promoted a “victim culture” which is psychologically damaging.  You cannot believe that you are the perpetual victim while at the same time believing that you are superior without it leading to some form of psychosis.

The elite of Jesus’ day established a hierocratic aristocracy who collaborated with an Edomite (Herod) who was willing to slaughter the innocents (infants) to maintain power.  Not much has changed.  The name Edom derives from the Hebrew “red” (edom a reference to red pottage and red earth=adam) and reminds me of Rothschild (Red Shield) a banker that needs driving out the temple.  The more things change the more they stay the same. To these people Jesus said;

"Ye are of your father the devil, and the lusts of your father ye will do. He was a murderer from the beginning, and abode not in the truth, because there is no truth in him. When he speaketh a lie, he speaketh of his own: for he is a liar, and the father of it" (John 8:44).

The Jews of Jesus day claimed Abraham as their father (John 8:39). This was the Abraham to which God made the promise that he would be his shield and very great reward (Gen 15:1).  Instead they turn to Red Shield. They turn to the shield of man who stands next to Abramovitch the Spirit cooker in front of a painting where Satan is summoning his legions.

Do you think that is a coincidence?  No it is a statement in defiance of God and his Christ.  They are flipping the finger.  Jacob (deceiver) Rothschild lives up to his name as the deceiver or trickster but he will be wrestled to a halt.  They have blood on their hands.  A lot of blood. Not just from the covid crisis but they helped manufacture the global Bolshevik dialectic, the rise of China and two world wars so that they could break up the Ottoman Empire and obtain the Balfour declaration. They run corporate America and own the Federal Reserve (a private bank) and they dictate to the Central Banks.   Moreover, they have utterly Epsteinized science and corrupted everything.  But I see you and I will not be silent.  I ask all Jews of good faith to distance themselves from this evil cabal that challenges God. Separate yourselves from the tents of Korah,Dathan and Abiram because they will perish (Num 16).

Tikkun Olam Heal the World

This is what we are dealing with.  A Jewish lady who sees meat as racist, white supremacist, colonialist, racist, sexist. These people are intolerant and insane. It is almost satire or stand up.

Carol Adams | Beyond Meat Debate | Propositon (6/7) | Oxford Union

I wish the Jewish people no harm but people like this do  them no favors. They are intolerant and self-righteous. Any world that they build will be worse than the one we have now.

Banking Crisis

My website Biblaridion is mentioned again at 4:02 and the blog post about the Turkish banking crisis is mentioned (https://www.biblaridion.info/blog/stealing-the-precious/). We would do well to remember that many influential Turkish families are Dönmeh. The Dönmeh were a group of Sabbatean crypto-Jews in the Ottoman Empire who converted outwardly to Islam, but retained their Jewish faith and Kabbalistic beliefs in secret.

The Anti-Defamation League (ADL)

Kevin mentions the ADL because they have been doxing the Canadian truckers online (calling them out..names and adresses etc) because the truckers are “racist” and obviously flag waving Nazis (as Trudeau indicated). The ADL is a very influential Jewish organization set up to fight antisemitism after the Leo Frank case in Atlanta. This is the ADL version of events:

The Temple At 150: Leo Frank (6 min)

Here are some things they do not tell you:

  • Frank was not targeted by an unruly mob. A 23-member grand jury that included five prominent members of the Jewish community voted for the indictment of Leo Frank. In other words, they all believed there was enough evidence to convict Leo Frank as the sole murderer of Mary Phagan. (See page 52, notes 102-106.)
  • Jim Conley was the second Black person that Leo Frank publicly accused of Mary Phagan’s murder. Newt Lee, the night watchman who found the body in the factory basement, was actively targeted by Frank’s hired private eyes. They actually planted a blood-soaked shirt in the innocent Black man’s home, and then told the police where they could find that damning “evidence.” At the same time, Frank altered Lee’s work time card in order to make Lee the prime suspect. (Pages 35-44.)

Books have been written calling out the ADL propaganda machine:

Review of Defamation Factory: The Sordid History of the ADL Paperback, Kaiter Enless, (Sept 22, 2018)

This is a concise and pointed view of the sordid history of the ADL. It begins with the Leo Frank case. Unfortunately the guilt or innocence of Leo Frank has been politicized. Jewish authors believe he was unfairly convicted. This is known as bias. The author presents 13 facts that support Frank's guilt. The most damming to me was Newt Lee's testimony that Frank had telephoned him the night of the murder to ask if everything was all right which was unprecedented. Further testimony by Lee supports Frank's involvement in the murder. Lee had no reason to go after Frank and the nature of his testimony does not suggest contrivance. The power of the Jewish community is undeniable when the sentence was commuted by Jewish pressure. The next chapter is the ADL versus Henry Ford. I have read the International Jew by Henry Ford and found it matter of fact and evidential. The comments on Aaron Sapiro bear further analysis. Reading the wiki page on this character one would suspect he was a crusader for the small farmer. Oh wait a minute Aaron was the attorney for the Chicago Laundry Owners Association. Seem pretty innocent. Al Capone was a used furniture salesman. The Laundry Association was the Jewish Mob. He was a close associate of Myer Lansky. That he was a sincere crusader for the small farmer beggars disbelief.
The next chapter is the ADL and Moe Dalitz the torch of liberty recipient. Moe Dalitz was a notorious Jewish mobster. The Al Capone of the Purple Gang otherwise known as the Jewish Navy. My God the ADL even put Myer Lansky's daughter on the board of directors. In the words of Abe Foxman if it walks like a duck...
The Next chapters deal with the despicable machinations of the ADL involving Pollard, Lyndon LaRouche and the outright criminal invasion of privacy by their operative Bullock.
We then turn to the Digital age and learn how this depraved organization led by Johnathan Greenblatt is the fount for developing tools to censor the internet. When finishing this book one is angered that such an organization would have any say in how our society is run. Kudos to Kaiter Enless.

Finally there is this website Little Mary Phagan by one of her descendants Mary Phagan-Kean, who believes her great-aunt and namesake, Mary Phagan was murdered and raped by Leo Frank in 1913.  Many Southern Jews were slave owners, slave traders and plantation owners (a number of them). Many northern Jews were rich industrialists. Mary Phagan was impoverished Irish and in their view one step up from a black slave. Who do I believe?  I believe the white jury which included five Jews.  Blacks were not allowed jury service. If any jury was going to be biased or racist it would have been that jury.  They found Leo Frank guilty.  I believe them.  The ADL is a racist, propagandist hate stirring terrorist organization. It perpetuates victimology based on lies. It should be abolished.

No apologies

So I make no apologies for calling out people who believe themselves racially superior. Unlike the ADL I do not believe all Jews share their ideology although I do think that many ordinary Jews have fallen victim to their own propaganda.  However, I am proud to stand beside Jews like Jesus Christ and the Apostle Paul and (like them) to be charged with antisemitism .

Mad Cow Disease

The scientific paper you need to look at is this:

Dr Kevin McCairn is not attributed in this paper but Doctor Flemming is. Doctor Flemming mentioned Kevin in his lecture as a world renowned brain specialist who first pointed out the danger of prion formation which can lead to all sorts of neurotropic diseases including dementia and Parkinsons as well as CJD.   This is a strong signal.  Not everyone will get CJD but I imagine that other brain diseases will increase (including Alzheimer).  All those people with brain fog?    Not good.  It all depends on your genetic make up but what with the vascular diseases (myocarditis) what has been done is criminal.  

Show notes with Dojo time stamps (they should take you to the Dojo version)

 

Brain Damage

Brain Damage

These are the articles discussed by Kevin in his 4 hour 40 min stream. Dr McCairn warned from the very beginning that there would be neurological damage caused by the virus but also by the Spike-protein. He warned about Parkinson’s, amyloid formation, the danger of micro-clots, Lewy bodies, dementia and prions.  And guess what?  Kevin was right. People are gonna have a “whole load of Spike protein (not cocaine) running around their brain.  We told you so.   But go get your top-up booster.

SARS-CoV-2 spike protein S1 induces fibrin(ogen) resistant to fibrinolysis: implications for microclot formation in COVID-19

SARS-CoV-2 protein interacts with Parkinson’s protein, promotes amyloid formation. Interactions between SARS-CoV-2 N-Protein and α-Synuclein Accelerate Amyloid Formation

Potential coupling between SARS-CoV-2 replicative fitness and interactions of its nucleoprotein with human 14-3-3 proteins

Highly efficient intercellular spreading of protein misfolding mediated by viral ligand-receptor interactions
Abstract
Protein aggregates associated with neurodegenerative diseases have the ability to transmit to unaffected cells, thereby templating their own aberrant conformation onto soluble homotypic
proteins. Proteopathic seeds can be released into the extracellular space, secreted in association with extracellular vesicles (EV) or exchanged by direct cell-to-cell contact. The extent
to which each of these pathways contribute to the prion-like spreading of protein misfolding is unclear. Exchange of cellular cargo by both direct cell contact or via EV depends on
receptor-ligand interactions. We hypothesized that enabling these interactions through viral ligands enhances intercellular proteopathic seed transmission. Using different cellular models
propagating prions or pathogenic Tau aggregates, we demonstrate that vesicular stomatitis virus glycoprotein and SARS-CoV-2 spike S increase aggregate induction by cell contact or
ligand-decorated EV. Thus, receptor-ligand interactions are important determinants of intercellular aggregate dissemination. Our data raise the possibility that viral infections contribute to proteopathic seed spreading by facilitating intercellular cargo transfer

Do you see the above abstract?  I got banned of twitter for a week for posting that the S-protein can spread in EV’s and exosomes.  I was especially interested in Kevin’s answer about tinnitus (3:40) which I am suffering from since I blacked out and fell from a wall (building the chicken coup). I had very swollen feet and leg cramps. Doctors could not find anything on all the blood tests (including dimer) nothing on ultra sound etc.  Second blood test high calcium but I have not been back. Self treatment with garlic and baby aspirin and the swelling disappeared.   I am now on full supplement regime and losing some weight and walking every day.  Feet appear normal now but still slight tinnitus.  What these people have done is unforgivable.   There will be a reckoning.  Starts at 14:29 usual language warning:

Further Resources

Everything we warned about has been proven. This is gene therapy and can be used to re-program cells. Constant vaccination would create ADE and brain damage.

Application of Modified mRNA in Somatic Reprogramming to Pluripotency and Directed Conversion of Cell Fate

 

 

 

 

 

What don’t you understand?

Covid is dangerous and so is the spike protein.   Both can cause damage.  They released a bioweapon and have indemnity.  They want to hurt your children.  What don’t you understand?   They are experimenting and their experiment is failing.  What don’t you understand?   When are you going to wise up?    Is Omicron milder?   It looks that way (for now) but what are the long term consequences?   Who knows?  Whatever you do there are risks.  You should be angry.  Very angry. But not with the so called “anti-vaxxers”.   Be angry with the people who released and made this abomination and who stole your lives.

CJD, Amyloid and K26R

CJD, Amyloid and K26R

The latest Kevin McCairn stream edited and split into three videos.  The first is a short video expanding on the topic from the previous video:  Global Prion Disease Treatment Market – Industry Trends and Forecast to 2028

Mad cows or crazy people? (5 mins)

Amyloid plaques (1 hour)

Resources

Presence of a SARS-CoV-2 Protein Enhances Amyloid Formation of Serum Amyloid A

GISAID Initiative

NCBI Sars CoV-2 Resources

Second entry looking for E-protein (envelope protein)

=====================
/product=”envelope protein”
/protein_id=”UBC57849.1″
/translation=”MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCC
NIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV”
=====================
Paste sequence in PLAAC:

MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV

PLAAC: Prion-Like Amino Acid Composition

Another paper on amyloid formation:

Interactions between SARS-CoV-2 N-protein and α-synuclein accelerate amyloid formation

 

ACE2 and the JEW: K26R to bind or not to bind that is the question? (15 min)

The following paper was published in Nature on 12 April 2021: Human ACE2 receptor polymorphism and altered susceptibility to SARS-CoV-2

"Among the variants tested, ACE2 K26R, consistent with its increased affinity for S-RBD observed in the biochemical assay, was the most effective (Ki 30 nM; ~33 fold greater than WT) in blocking viral entry (Fig. 5 and Table 1)".

"We also show that another ACE2 residue, K26, plays an important role in controlling the susceptibility to viral infections via a similar mechanism. Our structural analysis has suggested that K26R mutation will weaken coordination of the N90-linked glycan presumably interfering with its ability to shield the host from the viral infection. Our biochemical binding assays confirmed the predicted increased affinity for K26R ACE2 for S-protein. In fact, K26R ACE2 was the most effective among mutants tested for their ability to enhance viral entry, suggesting that this frequent polymorphism, very likely increases susceptibility to SARS-CoV-2 (Fig. 5 and Table 1)".

The above article in Nature says that K26R blocks the virus….in other words Ashkenazi Jews would be the most susceptible to covid. This goes completely contrary articles which state that the Jews are the least susceptible to covid such as this one: ACE2 coding variants in different populations and their potential impact on SARS-CoV-2 binding affinity. Look at the bar chart in the tweet below at the binding energy of K26R.

We also have another study that states;

Amish (AMI) and Ashkenazi Jewish (ASJ) populations do not appear to carry such variants in ACE2 coding regions (Fig. 1b). 
New insights into genetic susceptibility of COVID-19: an ACE2 and TMPRSS2 polymorphism analysis

So who is correct? A far as I am concerned anything published in Nature is suspect. The Indian author Somasekar Seshagiri works for Modmab Therapeutics Corporation is located in Foster City  California and  received a Coronavirus-related PPP loan from the SBA of $124,434.00 in April, 2020. Moreover, he went to the University of Georgia (in Athens, GA, US) where the Institute of Bioinformatics (founded 2002) with links to CDC has as director Jessica Kissinger.   Now Kissinger is an unusual name.  I am sure I heard it somewhere else (lolz).  Is she related to Henry?  Henry and his brother both have children and grand children. His mother (Mrs Kissinger) who died age 97 (Henry is 96 now)  was survived by two sons, as well as six grandchildren and six great-grandchildren.

These authors contributed equally: Kushal Suryamohan, Devan Diwanji, Eric W. Stawiski.
Cardiovascular Research Institute, University of California San Francisco.  The article they have just released was based on one that was written nearly exactly a year earlier (April 10, 2020). From memory this was about the time that the NYT posted an web article showing the complete genome sequence including 3D models of all the proteins.  The one released a year earlier Human ACE2 receptor polymorphisms predict SARS-CoV-2 susceptibility says something similar:

"....and thereby potentially alter host susceptibility. In particular, human ACE2 variants S19P, I21V, E23K, K26R, T27A, N64K, T92I, Q102P and H378R are predicted to increase susceptibility". 

It has many more authors (who seem to be have fallen away from this version): Eric W. Stawiski, Devan Diwanji, Kushal Suryamohan, Ravi Gupta, Frederic A. Fellouse, J. Fah Sathirapongsasuti, Jiang Liu, Ying-Ping Jiang, Aakrosh Ratan, Monika Mis, Devi Santhosh, Sneha Somasekar, Sangeetha Mohan, Sameer Phalke, Boney Kuriakose, Aju Antony, Jagath R. Junutula, Stephan C. Schuster, Natalia Jura, Somasekar Seshagiri.

This was a comment that I found under the article (the first one):

Comment: Ivan Shabalin

 
The paper describes an interesting idea, but the structural analysis and the predictions of the effects of the mutations are unsubstantiated and should be significantly revised.

For example, the presented analysis of the first mutation - K26R - has the following red flags:

- Figure 3b shows sugar labelled as "mannose", whereas the first sugar in glicosilated mammalian proteins should be N-acetylglucosamine (GlcNAc, or NAG), as it is in the crystal structures used for the analysis.

- The claim "We predict that K26R would abrogate stabilizing polar
contacts with N90, impairing coordination of the glycan (Figure 3b) and lead to an increase in the affinity of the virus to the ACE2 receptor" seems completely baseless. First, K and R are positively charged residues with similar lengths; I'm not convinced this mutation would necessarily abrogate the contact with NAG. Second, why would R form the predicted interaction with D-30? why not with Glu23, which is closer? Third, the following claim is very questionable "At the same time, R26 is now primed to establish backbone and side chain interactions with ACE2 D30 which then is poised to build a salt-bridge with CoV-2 RBD K417". In what way the proposed interaction R26-D30 would make D30 more prone to forming the salt bridge with K417? If anything, it would only decrease the strength of the bridge be being a "charge competitor". And, the salt bridge D30-K417 already exists in one of the structures they analyzed (6LZG).

Similarly, there are issues in the analysis of the second mutation:
- "The T27A mutant (Figure 3c) removes side chain-backbone and backbone-backbone interactions between T27 and E30 likely increasing the local dynamics of helix α1". First, there is a typo - it is E23. Second, the stability of a helix is mostly set by the C=O...N bonds between main-chain atoms, and the elimination of a side chain H-bond is unlikely to have a significant effect on the shape of the helix. Then, "This would allow the N-terminus of α1 to bend slightly and accommodate the unique CoV-2 RBD receptor binding-ridge loop that more intimately contacts ACE2 compared to its SARS-CoV counterpart" sounds very much unsubstantiated. To draw these conclusiong, MD simulations might need to be not perfomed.

Clearly, the analysis of other mutations is also questionable.

I believe that the Nature article is involved in a  cover up.

Ashkenazi Jews and the Amish people are related and they carry a similar polymorphism not just on ACE2 but other genes.   Moreover,  Jews are less susceptible to respiratory disease. The paragraph below  is from the blog article with the title:  Bio-war race targeting (McCairn1).

Ethnic Targeting

A number of questions come to my mind. In the paper discussed by Kevin the Jews and the Amish have a similar genetic polymorphism that protects them from Covid.  This means that  the Amish and the Jews are related. The history of the Amish church began with a schism in Switzerland within a group of Swiss and Alsatian Mennonite Anabaptists in 1693 led by Jakob Ammann. Those who followed Ammann became known as Amish. … In the early 18th century, many Amish and Mennonites immigrated to Pennsylvania for a variety of reasons. Not only do the Amish share a polymorphism with Ashkenazi Jews that makes them resistant to covid they share genetic loci for myopia (Fine-mapping of candidate region in Amish and Ashkenazi families confirms linkage of refractive error to a QTL on 1p34-p36). Anabaptists and Jews have had interactions for several centuries, since the origins of Anabaptism in the Radical Reformation in early modern Europe. Due to the insularity of many Anabaptist and Jewish communities, Anabaptist–Jewish relations have historically been limited but there are notable examples of interactions between Anabaptists and Jews. Due to some similarities in dress, culture, and language, Amish and Mennonite communities in particular have often been compared and contrasted to Hasidic Jewish communities (Wikipedia).The Mennonite Metzler family, tracing their lineage of descent through Valentine Metzler, a German immigrant who arrived in Lancaster County with his father Jacob in 1738, has close Y-DNA matches to Jewish families such as Kronik (in Belarus), Cohen and Langer (in Ukraine) and Friedman and Wengrowski (in Poland). [Anabaptisthistorians].  So, that solves that mystery. At some stage Ashkenazi Jews and Annabaptists must have interbred in Europe.

Not just  the study cited by Kevin but this one also presents a similar finding:

Here, we have analyzed the genetic markers of the TMPRSS2 gene and the differences in their alternative allele frequencies (AFs) among populations to identify possible susceptibility loci to COVID-19 and to correlate them with disease epidemiology. *AF= alternative allele frequencies (AFs). Regarding the non-synonymous pathogenic variants, we observed the highest AF among the Ashkenazi Jewish (ASJ) population (Figure 1A), while the Finnish (FIN) showed the highest AF among European subpopulations (Figure S2A). 
Genetic Analysis of the Coronavirus SARS-CoV-2 Host Protease TMPRSS2 in Different Populations

And this article from 2009:

DENVER — Researchers at National Jewish Health and the University of Colorado Denver have discovered a gene that is associated with improved survival among patients with acute lung injury. Acute lung injury (ALI) is often caused by a respiratory infection and results in low oxygen levels in the blood, and fluid in the lungs. It is one of the most vexing problems for intensive care units, afflicting almost 200,000 people in the United States each year, and killing 40 percent of them. https://www.nationaljewish.org/about/news/press-releases/2009/acute-lung-injury

And this paper:

The K26R (rs4646116) variant is an ACE2 variant that facilitates the binding of the S-glycoprotein effective in binding the coronavirus to the host cell and increases the susceptibility to the virus. The K26R variant, which reduces virus binding to the ACE2 receptor, has been found to be more concentrated in the Jewish population (1.2%) and, in contrast, the Asian population has the lowest allele frequency for the single nucleotide variant encoding K26R*

* Al-Mulla F, Mohammad A, Madhoun AA, Haddad D, Ali H, Eaaswarkhanth M, et al. A comprehensive germline variant and expression analyses of ACE2, TMPRSS2 and SARS-CoV-2 activator FURIN genes from the Middle East: Combating SARS-CoV-2 with precision medicine. bioRxiv 2020
Effects of Human Genetic Factors (Ethnicity and Race) on Clinical Severity of SARS-CoV-2 (COVID-19)Journal of Experimental and Basic Medical Sciences 2020;1(3):147-158

Covid Zombies

Covid Zombies

Important this represents 20 hrs of viewing  (four days) edited down into short videos.  The resources are also included.

Dr Kevin McCairn has been collecting clips of people behaving strangely. His “raccoons” send him clips they find on twitter and Facebook etc and he saves them in the “Covid Zombie” file. You can see people licking things, having meltdowns (mostly women), being aggressive etc. Dr McCairn suggests that a lot of this behavior is due to certain areas of the brain being infected. Those areas regulate emotion and impulse control. The “basal ganglia” refers to a group of sub-cortical nuclei responsible primarily for motor control, as well as other roles such as motor learning, executive functions and behaviors, and emotions. Now this may seem fanciful but the number of car accidents in the USA has shot through the roof. That would fit a theory of lack of impulse control. A lot of people are also experiencing “brain-fog”. Note that those symptoms can come from Covid or from the vaccine. They both contain the spike protein.

 

The Mechanisms

The mechanism for entering the brain is described in the videos below. One of the videos shows that prions can possibly be spread through the nose. In the end it will make no difference whether you are vaccinated or unvaccinated. In my view it will come down to genetics and natural immunity so you better get on your knees and start praying. And never forget that this was no accident. These people are truly evil and insane.

New pathway discovered for prions to enter the brain

They fuse everything into one cell. Fancy being an amoeba?

Prions running around my brain (18 mins)

Madcow not Maddow (30 mins)

Mad cow? But the vaccine does not contain bovine serum (idiot response from Dr Gorski).

Weaponized Snot (8 mins)

Ready, aim, fire. Make sure you blow that snot at Fauci and his mate disease-sack

The Good, the Bad and the Ugly

The Good, the Bad and the Ugly of bio warfare. There is an active but hidden biological weapons program institutionalized in the United States government, private industry, and university system; a collaborative franchise led by a cult of scientism that is now completely out of control. They work with no liability, neither for themselves or for the governmental agencies that protect their biological weaponization work, work that is directly influenced by transhumanism and by synthetic biology and synthetic environments.

My name is Clint (20 mins)

The vaccinated are, or are in the process of becoming, the transhumanist chimera.

 Resources for above video

Wagging the Dog Part 2: The Story Behind The Story Of Covid-19 (The Condensed Cut)

Luc Montagnier HIV Nobel Prize Winner Says Virus “Bio-engineered” in Lab

Mycoplasmas, HIV and Covid (1 hr 15 mins)

What does the Gulf War and Covid pandemic have in common? HIV

Mycoplasma (plural mycoplasmas or mycoplasmata) is a genus of bacteria that lack a cell wall around their cell membranes. This characteristic makes them naturally resistant to antibiotics that target cell wall synthesis they can be parasitic or saprotrophic. Several species are pathogenic in humans.

The development, testing and illegal transfer of biological weapons to Iraq. That includes the
insertion of The HIV Genome gp120 into mycoplasmas.The real worry of the military was biological war which is why they vaccinated their military. It is also the reason why so many came back with gulf war syndrome.

I would not be surprised if it was all set up like in WW1. War is a great time to experiment. You have so many healthy young subjects. If you were really evil you might even leak your bio-tech to the enemy so that you have an excuse to vaccinate the troops. You have to get it through your head that these people do not care about countries. They don’t care about human life either. That is the nature of a psychopath.

Covid also ha a gp120 HIV insert. Remember this article by Indian scientists (I do)
Uncanny similarity of unique inserts into the 2019-nVoV spike protein to HIV-1 gp129 and Gag

It was withdrawn.It was not China that put pressure on to withdraw the article. Now let me think…who was deeply involved with the AIDS pandemic?

Resources for above video

Dr. Garth L. Nicolson : Weaponized Mycoplasmas (Non-lethal Biological Warfare)

And yes that is a syrup he has on his head.

http://www.immed.org

 Culture war and psychological war

These are official results but the website makes them difficult to find.  Try this page TGA Medicine Summary and enter different search terms and dates etc.

Sick Country (2mins)

Kevin also comments on the ideological subversion that is now happening. They are coming for the kids. You are in a bio-war and a psychological war but remember all sides are playing this.

G’day. One of the first things you’ll hear when in Australia, is the classic “G’day, mate”, which is basically the same as saying, “good day”, or “hello”. However it no longer means “hello”. G’day now means have a Gay Day. You kids might get lucky and be turned into an Antifa terrorist by their teacher who will have them spreading fascism and supervision instead of doing homework.

Ideological Subversion (6 mins)

Conclusion

We are under attack the enemy is a corporate entity with tentacles in every country and every institution.

Mad Cows and ADE

Mad Cows and ADE

The last  three hour show has been edited down to twelve two minute tweets and I have added the linked articles.

 

Protein miss-folding and Prions

Protein miss-folding and Prions

Covid is not just a respiratory disease and lest we forget, the vaccine itself (the gene therapy) is based on the covid spike. It is the spike protein that is toxic and your cells are being instructed to produce them. That is a recipe for autoimmune diseases and inflammation. 

We are being lied to and gas-lighted on a massive scale.  Not only is Covid a bio-weapon the “vaccine” is actually gene therapy which is also dual use technology. The public is being forced into a One Health agenda with an mRNA platform offering “personalized health” at a price. However, that same technology can be used for nefarious purposes. There is also the problem of the destruction and replacement of our innate immunity with corporate health care (the Marek disease route as indicated by Geert Vanden Bossche ). They are preparing for the commoditization of every aspect of our lives, whether health, education or work. Everything on the blockchain. Bio-digital convergence.

The dangers of Covid are only now coming to light. While it is true that more than 99% under the age of seventy survive and only experience mild initial symptoms it does seem that “long Covid” exists. Covid is therefore incapacitating and evidence is emerging that it has neurological effects. It will take time for these to fully develop. It effects men worse than women and is racially selective.  Nice characteristics for a bio-weapon.

The spike protein crosses the blood brain barrier and can cause protein miss-folding which is the formation of prions. There is no safe dose of prions.   The neurological effects can be devastating – CDJ (mad cow), Alzheimer, Dementia, Parkinson,etc come to mind.

So, initially Covid causes respiratory disease and triggers a cytokine storm (hyper inflammatory response) in some.  Others suffer a mild dose or no symptoms at all…..but….what does the future hold?  Accelerated neurological degeneration?  Cancers?

Similarly, the gene therapy (so called vaccine) which is based on the spike protein can cause cardiovascular problems such as thrombosis with thrombocytopenia syndrome (TTS) and myocarditis which is an inflammation of the heart muscle (myocardium). And now there is every implication that it can cross the blood-brain barrier and trigger inflammation (just as Kevin McCairn was warning). This is extremely concerning especially because they want to inject children.

According to Dr Kevin McCairn the possibility exists that the PCR testing regime is used at such high cycle values in order to track the distribution of the bio-agent. Even if the viral load is insignificant and the patient is without initial symptoms and even if dead nucleotide is picked up the information might be useful from a civil defense perspective to model and track weapon effectiveness and estimate future casualties.

Multiple agendas and confusion

Their are multiple agendas at work which means that everyone is suspect.  From what I can see they wanted people to believe that Covid was a natural outbreak. However, if they wanted covid to be regarded as natural, then why release it next to a bio-lab?  Might as well put a sign up saying “China did it”.  Now that the natural origin narrative is crumbling they have lined up  China and Fauci as the cut outs.  Sacrifice a pawn to save the Queen.

There are obviously supra-national institutes involved as well as plutocratic and  oligarchical interests involved.  Is it a coincidence (sic) that the driving force behind Pharma in the West is Jewish, particularly when taking into account Jewish Tikkun Olam (Heal the World) eschatology. This is the Hegelian Dialectic in action.  First create the problem, then offer the solution.  They are going to do the same with the economy.  First destroy it then Build Back Better.

They want people arguing about mask wearing or about Ivermectin etc.  They do not want us digging into the origins of the virus. They have poisoned the internet and captured Main Stream Media. They have created limited hang outs and echo chambers that are meant to distract you from the real questions.  Many of those alt Media platforms never mention Israel or the Jews. They do not even mention banking. They are controlled opposition.

 

A 2.5 hour show condensed down to 40 minutes. The full version can be found at Kevin McCairns Dojo:

https://www.mccairndojo.com/

Trigger Warning – if you watch the Live Stream get ready to be offended (lol).

Latest COVIDZombie Neuroscience – It’s Not Looking Good Folks (40 mins)

 

 

Resources

These are the articles mentioned in the stream:

They removed it so here  is the trailer:

 

As a thread:

 

Prion

Prion

Finally it is making its way into the public square –despite very heavy censorship.  Dr Kevin McCairn  the neuroscientist has been warning for some time now that it looks like the spike protein can cross the blood-brain barrier and induce protein miss-folding.  That can lead to all sorts of neuro-degenerative diseases such as Alzheimer and even CJD (mad cow).

I have placed a video that is over 4 hours long in which Dr Flemming explains the science. Dr Fleming himself has been attacked and his reputation maligned for a FOI on the wrong person with regards to the Atkins diet. If you tread on the wrong toes in pharma or the health industry you quickly become a persona non grata and the stink follows you around. Here is an article that I wrote previously:

Dr Fleming issues alert

Before you watch the video (if you do) are two short tweets.  In the first 2 minute video Dr Fleming gives Dr. Kevin McCairn a shout-out:

In the second tweet Dr. Fleming discusses the spike protein:

 

Dr Fleming’s Website: https://www.flemingmethod.com/

 

Full video