CJD, Amyloid and K26R

CJD, Amyloid and K26R

The latest Kevin McCairn stream edited and split into three videos.  The first is a short video expanding on the topic from the previous video:  Global Prion Disease Treatment Market – Industry Trends and Forecast to 2028

Mad cows or crazy people? (5 mins)

Amyloid plaques (1 hour)

Resources

Presence of a SARS-CoV-2 Protein Enhances Amyloid Formation of Serum Amyloid A

GISAID Initiative

NCBI Sars CoV-2 Resources

Second entry looking for E-protein (envelope protein)

=====================
/product=”envelope protein”
/protein_id=”UBC57849.1″
/translation=”MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCC
NIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV”
=====================
Paste sequence in PLAAC:

MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV

PLAAC: Prion-Like Amino Acid Composition

Another paper on amyloid formation:

Interactions between SARS-CoV-2 N-protein and α-synuclein accelerate amyloid formation

 

ACE2 and the JEW: K26R to bind or not to bind that is the question? (15 min)

The following paper was published in Nature on 12 April 2021: Human ACE2 receptor polymorphism and altered susceptibility to SARS-CoV-2

"Among the variants tested, ACE2 K26R, consistent with its increased affinity for S-RBD observed in the biochemical assay, was the most effective (Ki 30 nM; ~33 fold greater than WT) in blocking viral entry (Fig. 5 and Table 1)".

"We also show that another ACE2 residue, K26, plays an important role in controlling the susceptibility to viral infections via a similar mechanism. Our structural analysis has suggested that K26R mutation will weaken coordination of the N90-linked glycan presumably interfering with its ability to shield the host from the viral infection. Our biochemical binding assays confirmed the predicted increased affinity for K26R ACE2 for S-protein. In fact, K26R ACE2 was the most effective among mutants tested for their ability to enhance viral entry, suggesting that this frequent polymorphism, very likely increases susceptibility to SARS-CoV-2 (Fig. 5 and Table 1)".

The above article in Nature says that K26R blocks the virus….in other words Ashkenazi Jews would be the most susceptible to covid. This goes completely contrary articles which state that the Jews are the least susceptible to covid such as this one: ACE2 coding variants in different populations and their potential impact on SARS-CoV-2 binding affinity. Look at the bar chart in the tweet below at the binding energy of K26R.

We also have another study that states;

Amish (AMI) and Ashkenazi Jewish (ASJ) populations do not appear to carry such variants in ACE2 coding regions (Fig. 1b). 
New insights into genetic susceptibility of COVID-19: an ACE2 and TMPRSS2 polymorphism analysis

So who is correct? A far as I am concerned anything published in Nature is suspect. The Indian author Somasekar Seshagiri works for Modmab Therapeutics Corporation is located in Foster City  California and  received a Coronavirus-related PPP loan from the SBA of $124,434.00 in April, 2020. Moreover, he went to the University of Georgia (in Athens, GA, US) where the Institute of Bioinformatics (founded 2002) with links to CDC has as director Jessica Kissinger.   Now Kissinger is an unusual name.  I am sure I heard it somewhere else (lolz).  Is she related to Henry?  Henry and his brother both have children and grand children. His mother (Mrs Kissinger) who died age 97 (Henry is 96 now)  was survived by two sons, as well as six grandchildren and six great-grandchildren.

These authors contributed equally: Kushal Suryamohan, Devan Diwanji, Eric W. Stawiski.
Cardiovascular Research Institute, University of California San Francisco.  The article they have just released was based on one that was written nearly exactly a year earlier (April 10, 2020). From memory this was about the time that the NYT posted an web article showing the complete genome sequence including 3D models of all the proteins.  The one released a year earlier Human ACE2 receptor polymorphisms predict SARS-CoV-2 susceptibility says something similar:

"....and thereby potentially alter host susceptibility. In particular, human ACE2 variants S19P, I21V, E23K, K26R, T27A, N64K, T92I, Q102P and H378R are predicted to increase susceptibility". 

It has many more authors (who seem to be have fallen away from this version): Eric W. Stawiski, Devan Diwanji, Kushal Suryamohan, Ravi Gupta, Frederic A. Fellouse, J. Fah Sathirapongsasuti, Jiang Liu, Ying-Ping Jiang, Aakrosh Ratan, Monika Mis, Devi Santhosh, Sneha Somasekar, Sangeetha Mohan, Sameer Phalke, Boney Kuriakose, Aju Antony, Jagath R. Junutula, Stephan C. Schuster, Natalia Jura, Somasekar Seshagiri.

This was a comment that I found under the article (the first one):

Comment: Ivan Shabalin

 
The paper describes an interesting idea, but the structural analysis and the predictions of the effects of the mutations are unsubstantiated and should be significantly revised.

For example, the presented analysis of the first mutation - K26R - has the following red flags:

- Figure 3b shows sugar labelled as "mannose", whereas the first sugar in glicosilated mammalian proteins should be N-acetylglucosamine (GlcNAc, or NAG), as it is in the crystal structures used for the analysis.

- The claim "We predict that K26R would abrogate stabilizing polar
contacts with N90, impairing coordination of the glycan (Figure 3b) and lead to an increase in the affinity of the virus to the ACE2 receptor" seems completely baseless. First, K and R are positively charged residues with similar lengths; I'm not convinced this mutation would necessarily abrogate the contact with NAG. Second, why would R form the predicted interaction with D-30? why not with Glu23, which is closer? Third, the following claim is very questionable "At the same time, R26 is now primed to establish backbone and side chain interactions with ACE2 D30 which then is poised to build a salt-bridge with CoV-2 RBD K417". In what way the proposed interaction R26-D30 would make D30 more prone to forming the salt bridge with K417? If anything, it would only decrease the strength of the bridge be being a "charge competitor". And, the salt bridge D30-K417 already exists in one of the structures they analyzed (6LZG).

Similarly, there are issues in the analysis of the second mutation:
- "The T27A mutant (Figure 3c) removes side chain-backbone and backbone-backbone interactions between T27 and E30 likely increasing the local dynamics of helix α1". First, there is a typo - it is E23. Second, the stability of a helix is mostly set by the C=O...N bonds between main-chain atoms, and the elimination of a side chain H-bond is unlikely to have a significant effect on the shape of the helix. Then, "This would allow the N-terminus of α1 to bend slightly and accommodate the unique CoV-2 RBD receptor binding-ridge loop that more intimately contacts ACE2 compared to its SARS-CoV counterpart" sounds very much unsubstantiated. To draw these conclusiong, MD simulations might need to be not perfomed.

Clearly, the analysis of other mutations is also questionable.

I believe that the Nature article is involved in a  cover up.

Ashkenazi Jews and the Amish people are related and they carry a similar polymorphism not just on ACE2 but other genes.   Moreover,  Jews are less susceptible to respiratory disease. The paragraph below  is from the blog article with the title:  Bio-war race targeting (McCairn1).

Ethnic Targeting

A number of questions come to my mind. In the paper discussed by Kevin the Jews and the Amish have a similar genetic polymorphism that protects them from Covid.  This means that  the Amish and the Jews are related. The history of the Amish church began with a schism in Switzerland within a group of Swiss and Alsatian Mennonite Anabaptists in 1693 led by Jakob Ammann. Those who followed Ammann became known as Amish. … In the early 18th century, many Amish and Mennonites immigrated to Pennsylvania for a variety of reasons. Not only do the Amish share a polymorphism with Ashkenazi Jews that makes them resistant to covid they share genetic loci for myopia (Fine-mapping of candidate region in Amish and Ashkenazi families confirms linkage of refractive error to a QTL on 1p34-p36). Anabaptists and Jews have had interactions for several centuries, since the origins of Anabaptism in the Radical Reformation in early modern Europe. Due to the insularity of many Anabaptist and Jewish communities, Anabaptist–Jewish relations have historically been limited but there are notable examples of interactions between Anabaptists and Jews. Due to some similarities in dress, culture, and language, Amish and Mennonite communities in particular have often been compared and contrasted to Hasidic Jewish communities (Wikipedia).The Mennonite Metzler family, tracing their lineage of descent through Valentine Metzler, a German immigrant who arrived in Lancaster County with his father Jacob in 1738, has close Y-DNA matches to Jewish families such as Kronik (in Belarus), Cohen and Langer (in Ukraine) and Friedman and Wengrowski (in Poland). [Anabaptisthistorians].  So, that solves that mystery. At some stage Ashkenazi Jews and Annabaptists must have interbred in Europe.

Not just  the study cited by Kevin but this one also presents a similar finding:

Here, we have analyzed the genetic markers of the TMPRSS2 gene and the differences in their alternative allele frequencies (AFs) among populations to identify possible susceptibility loci to COVID-19 and to correlate them with disease epidemiology. *AF= alternative allele frequencies (AFs). Regarding the non-synonymous pathogenic variants, we observed the highest AF among the Ashkenazi Jewish (ASJ) population (Figure 1A), while the Finnish (FIN) showed the highest AF among European subpopulations (Figure S2A). 
Genetic Analysis of the Coronavirus SARS-CoV-2 Host Protease TMPRSS2 in Different Populations

And this article from 2009:

DENVER — Researchers at National Jewish Health and the University of Colorado Denver have discovered a gene that is associated with improved survival among patients with acute lung injury. Acute lung injury (ALI) is often caused by a respiratory infection and results in low oxygen levels in the blood, and fluid in the lungs. It is one of the most vexing problems for intensive care units, afflicting almost 200,000 people in the United States each year, and killing 40 percent of them. https://www.nationaljewish.org/about/news/press-releases/2009/acute-lung-injury

And this paper:

The K26R (rs4646116) variant is an ACE2 variant that facilitates the binding of the S-glycoprotein effective in binding the coronavirus to the host cell and increases the susceptibility to the virus. The K26R variant, which reduces virus binding to the ACE2 receptor, has been found to be more concentrated in the Jewish population (1.2%) and, in contrast, the Asian population has the lowest allele frequency for the single nucleotide variant encoding K26R*

* Al-Mulla F, Mohammad A, Madhoun AA, Haddad D, Ali H, Eaaswarkhanth M, et al. A comprehensive germline variant and expression analyses of ACE2, TMPRSS2 and SARS-CoV-2 activator FURIN genes from the Middle East: Combating SARS-CoV-2 with precision medicine. bioRxiv 2020
Effects of Human Genetic Factors (Ethnicity and Race) on Clinical Severity of SARS-CoV-2 (COVID-19)Journal of Experimental and Basic Medical Sciences 2020;1(3):147-158

Covid Zombies

Covid Zombies

Important this represents 20 hrs of viewing  (four days) edited down into short videos.  The resources are also included.

Dr Kevin McCairn has been collecting clips of people behaving strangely. His “raccoons” send him clips they find on twitter and Facebook etc and he saves them in the “Covid Zombie” file. You can see people licking things, having meltdowns (mostly women), being aggressive etc. Dr McCairn suggests that a lot of this behavior is due to certain areas of the brain being infected. Those areas regulate emotion and impulse control. The “basal ganglia” refers to a group of sub-cortical nuclei responsible primarily for motor control, as well as other roles such as motor learning, executive functions and behaviors, and emotions. Now this may seem fanciful but the number of car accidents in the USA has shot through the roof. That would fit a theory of lack of impulse control. A lot of people are also experiencing “brain-fog”. Note that those symptoms can come from Covid or from the vaccine. They both contain the spike protein.

 

The Mechanisms

The mechanism for entering the brain is described in the videos below. One of the videos shows that prions can possibly be spread through the nose. In the end it will make no difference whether you are vaccinated or unvaccinated. In my view it will come down to genetics and natural immunity so you better get on your knees and start praying. And never forget that this was no accident. These people are truly evil and insane.

New pathway discovered for prions to enter the brain

They fuse everything into one cell. Fancy being an amoeba?

Prions running around my brain (18 mins)

Madcow not Maddow (30 mins)

Mad cow? But the vaccine does not contain bovine serum (idiot response from Dr Gorski).

Weaponized Snot (8 mins)

Ready, aim, fire. Make sure you blow that snot at Fauci and his mate disease-sack

The Good, the Bad and the Ugly

The Good, the Bad and the Ugly of bio warfare. There is an active but hidden biological weapons program institutionalized in the United States government, private industry, and university system; a collaborative franchise led by a cult of scientism that is now completely out of control. They work with no liability, neither for themselves or for the governmental agencies that protect their biological weaponization work, work that is directly influenced by transhumanism and by synthetic biology and synthetic environments.

My name is Clint (20 mins)

The vaccinated are, or are in the process of becoming, the transhumanist chimera.

 Resources for above video

Wagging the Dog Part 2: The Story Behind The Story Of Covid-19 (The Condensed Cut)

Luc Montagnier HIV Nobel Prize Winner Says Virus “Bio-engineered” in Lab

Mycoplasmas, HIV and Covid (1 hr 15 mins)

What does the Gulf War and Covid pandemic have in common? HIV

Mycoplasma (plural mycoplasmas or mycoplasmata) is a genus of bacteria that lack a cell wall around their cell membranes. This characteristic makes them naturally resistant to antibiotics that target cell wall synthesis they can be parasitic or saprotrophic. Several species are pathogenic in humans.

The development, testing and illegal transfer of biological weapons to Iraq. That includes the
insertion of The HIV Genome gp120 into mycoplasmas.The real worry of the military was biological war which is why they vaccinated their military. It is also the reason why so many came back with gulf war syndrome.

I would not be surprised if it was all set up like in WW1. War is a great time to experiment. You have so many healthy young subjects. If you were really evil you might even leak your bio-tech to the enemy so that you have an excuse to vaccinate the troops. You have to get it through your head that these people do not care about countries. They don’t care about human life either. That is the nature of a psychopath.

Covid also ha a gp120 HIV insert. Remember this article by Indian scientists (I do)
Uncanny similarity of unique inserts into the 2019-nVoV spike protein to HIV-1 gp129 and Gag

It was withdrawn.It was not China that put pressure on to withdraw the article. Now let me think…who was deeply involved with the AIDS pandemic?

Resources for above video

Dr. Garth L. Nicolson : Weaponized Mycoplasmas (Non-lethal Biological Warfare)

And yes that is a syrup he has on his head.

http://www.immed.org

 Culture war and psychological war

These are official results but the website makes them difficult to find.  Try this page TGA Medicine Summary and enter different search terms and dates etc.

Sick Country (2mins)

Kevin also comments on the ideological subversion that is now happening. They are coming for the kids. You are in a bio-war and a psychological war but remember all sides are playing this.

G’day. One of the first things you’ll hear when in Australia, is the classic “G’day, mate”, which is basically the same as saying, “good day”, or “hello”. However it no longer means “hello”. G’day now means have a Gay Day. You kids might get lucky and be turned into an Antifa terrorist by their teacher who will have them spreading fascism and supervision instead of doing homework.

Ideological Subversion (6 mins)

Conclusion

We are under attack the enemy is a corporate entity with tentacles in every country and every institution.

Mad Cows and ADE

Mad Cows and ADE

The last  three hour show has been edited down to twelve two minute tweets and I have added the linked articles.

 

Protein miss-folding and Prions

Protein miss-folding and Prions

Covid is not just a respiratory disease and lest we forget, the vaccine itself (the gene therapy) is based on the covid spike. It is the spike protein that is toxic and your cells are being instructed to produce them. That is a recipe for autoimmune diseases and inflammation. 

We are being lied to and gas-lighted on a massive scale.  Not only is Covid a bio-weapon the “vaccine” is actually gene therapy which is also dual use technology. The public is being forced into a One Health agenda with an mRNA platform offering “personalized health” at a price. However, that same technology can be used for nefarious purposes. There is also the problem of the destruction and replacement of our innate immunity with corporate health care (the Marek disease route as indicated by Geert Vanden Bossche ). They are preparing for the commoditization of every aspect of our lives, whether health, education or work. Everything on the blockchain. Bio-digital convergence.

The dangers of Covid are only now coming to light. While it is true that more than 99% under the age of seventy survive and only experience mild initial symptoms it does seem that “long Covid” exists. Covid is therefore incapacitating and evidence is emerging that it has neurological effects. It will take time for these to fully develop. It effects men worse than women and is racially selective.  Nice characteristics for a bio-weapon.

The spike protein crosses the blood brain barrier and can cause protein miss-folding which is the formation of prions. There is no safe dose of prions.   The neurological effects can be devastating – CDJ (mad cow), Alzheimer, Dementia, Parkinson,etc come to mind.

So, initially Covid causes respiratory disease and triggers a cytokine storm (hyper inflammatory response) in some.  Others suffer a mild dose or no symptoms at all…..but….what does the future hold?  Accelerated neurological degeneration?  Cancers?

Similarly, the gene therapy (so called vaccine) which is based on the spike protein can cause cardiovascular problems such as thrombosis with thrombocytopenia syndrome (TTS) and myocarditis which is an inflammation of the heart muscle (myocardium). And now there is every implication that it can cross the blood-brain barrier and trigger inflammation (just as Kevin McCairn was warning). This is extremely concerning especially because they want to inject children.

According to Dr Kevin McCairn the possibility exists that the PCR testing regime is used at such high cycle values in order to track the distribution of the bio-agent. Even if the viral load is insignificant and the patient is without initial symptoms and even if dead nucleotide is picked up the information might be useful from a civil defense perspective to model and track weapon effectiveness and estimate future casualties.

Multiple agendas and confusion

Their are multiple agendas at work which means that everyone is suspect.  From what I can see they wanted people to believe that Covid was a natural outbreak. However, if they wanted covid to be regarded as natural, then why release it next to a bio-lab?  Might as well put a sign up saying “China did it”.  Now that the natural origin narrative is crumbling they have lined up  China and Fauci as the cut outs.  Sacrifice a pawn to save the Queen.

There are obviously supra-national institutes involved as well as plutocratic and  oligarchical interests involved.  Is it a coincidence (sic) that the driving force behind Pharma in the West is Jewish, particularly when taking into account Jewish Tikkun Olam (Heal the World) eschatology. This is the Hegelian Dialectic in action.  First create the problem, then offer the solution.  They are going to do the same with the economy.  First destroy it then Build Back Better.

They want people arguing about mask wearing or about Ivermectin etc.  They do not want us digging into the origins of the virus. They have poisoned the internet and captured Main Stream Media. They have created limited hang outs and echo chambers that are meant to distract you from the real questions.  Many of those alt Media platforms never mention Israel or the Jews. They do not even mention banking. They are controlled opposition.

 

A 2.5 hour show condensed down to 40 minutes. The full version can be found at Kevin McCairns Dojo:

https://www.mccairndojo.com/

Trigger Warning – if you watch the Live Stream get ready to be offended (lol).

Latest COVIDZombie Neuroscience – It’s Not Looking Good Folks (40 mins)

 

 

Resources

These are the articles mentioned in the stream:

They removed it so here  is the trailer:

 

As a thread:

 

Prion

Prion

Finally it is making its way into the public square –despite very heavy censorship.  Dr Kevin McCairn  the neuroscientist has been warning for some time now that it looks like the spike protein can cross the blood-brain barrier and induce protein miss-folding.  That can lead to all sorts of neuro-degenerative diseases such as Alzheimer and even CJD (mad cow).

I have placed a video that is over 4 hours long in which Dr Flemming explains the science. Dr Fleming himself has been attacked and his reputation maligned for a FOI on the wrong person with regards to the Atkins diet. If you tread on the wrong toes in pharma or the health industry you quickly become a persona non grata and the stink follows you around. Here is an article that I wrote previously:

Dr Fleming issues alert

Before you watch the video (if you do) are two short tweets.  In the first 2 minute video Dr Fleming gives Dr. Kevin McCairn a shout-out:

In the second tweet Dr. Fleming discusses the spike protein:

 

Dr Fleming’s Website: https://www.flemingmethod.com/

 

Full video

Ten out of Ten (TLAV)

Ten out of Ten (TLAV)

This is probably the best news show I have ever seen from Ryan on The Last American Vagabond.  This show is only two hours (not his usual four) and is an absolute cracker.

If you want to know what is going on watch the full show – a large section is dedicated to discussing the scientific papers regarding the spike protein.  It is in my view undeniable that the vaccine is causing  deaths that have “covid-like” symptoms.

However, it gets worse and more mysterious.  The head of Astra Zeneca RD Jose Baselga died of very rapid onset CJD (Creutzfeldt-Jakob disease) which is related to mad cow disease (was he vaccinated?).  It is a prion disease which is caused when the protein folds the wrong way.  CJD is rare but cases are suddenly appearing (and being kept quiet).  Scientific papers have warned that this can be caused by the covid spike.   It looks like the vaccine is causing this and turning people into zombies.

The start of the video begins discusses how Israel is committing war crimes in Gaza and continues by discussing a document by Israeli citizens (doctors etc) about the abusive and authoritarian behavior of their own government. So it is not just the Palestinians who are suffering.   The video ends by discussing India and the vaccination deaths. I highly recommend watching this video.

The Spike Protein In COVID Vaccines Is Putting You At Serious Risk, According To The Science

Odysee version:

Website= https://www.thelastamericanvagabond.com/spike-protein-covid-vaccines-putting-you-aserious-risk-according-science/

Video Source Links (In Chronological Order):

https://twitter.com/YoureAllDunces/status/1386734889387663363

https://www.thelastamericanvagabond.com/as-yemen-war-intensifies-biden-set-to-resume-weapons-sales/

https://twitter.com/YoureAllDunces/status/1386781039427719171

Israel

https://www.americasfrontlinedoctors.com/wp-content/uploads/The-Israeli-People-Committee-Interim-Conclusion-Report-April-2021.pdf

https://lockdownsceptics.org/2021/04/24/israel-investigating-link-between-pfizer-covid-vaccine-and-heart-problem-in-men-under-30/

Vaccines

https://twitter.com/DailyExposeNews/status/1386217530600087554

https://twitter.com/9thfloor/status/1386637017954533377

https://twitter.com/HPVSideEffects/status/1386757252950994950

https://www.nytimes.com/2021/04/25/business/covid-vaccines-second-doses.html

https://twitter.com/YoureAllDunces/status/1386071034001084422

https://www.washingtonpost.com/health/2021/04/23/cdc-recommends-covid-vaccine-pregnant-women/

https://pbs.twimg.com/media/Ezx-YTHXoAUjA0r?format=jpg&name=large

https://www.cbsnews.com/news/covid-college-vaccine-requirement/

https://www.cbsnews.com/news/covid-vaccine-houston-hospital-fire-workers-refuse/

https://twitter.com/YoureAllDunces/status/1386127080635650054

https://twitter.com/YoureAllDunces/status/1386122269760671746

https://www.sec.gov/Archives/edgar/data/1682852/000168285220000017/mrna-20200630.htm

Spike Protein

https://www.bitchute.com/video/oJ9Apy9mqZJ8/

https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7547916/

https://www.templehealth.org/about/news/sars-cov-2-spike-proteins-disrupt-the-blood-brain-barrier-potentially-raising-risk-of-neurological-damage-in-covid-19-patients

https://twitter.com/Kevin_McKernan/status/1386642249782636544

https://pubmed.ncbi.nlm.nih.gov/25425209/

https://www.jimmunol.org/content/198/1_Supplement/153.20

https://www.mdpi.com/2076-393X/9/1/36/htm

https://jhoonline.biomedcentral.com/articles/10.1186/s13045-020-00954-7

https://twitter.com/_taylorhudak/status/1385067952534401027

https://twitter.com/_taylorhudak/status/1382075024190935058

https://www.ata.org/tinnitus-and-coronavirus

http://sahac.com/tinnitus/what-are-the-symptoms-of-tinnitus/

Jose Baselga

https://www.reuters.com/article/us-astrazeneca-baselga/astrazenecas-head-of-rd-for-oncology-dies-at-61-idUSKBN2BD0PB

https://www.youtube.com/watch?v=rth8NfrSJS8

https://pharmaphorum.com/news/shock-as-astrazenecas-charismatic-cancer-rd-chief-jose-baselga-dies/

https://www.cdc.gov/prions/cjd/index.html

https://scivisionpub.com/pdfs/covid19-rna-based-vaccines-and-the-risk-of-prion-disease-1503.pdf

https://nypost.com/2021/03/31/mysterious-brain-disease-cluster-probed-in-canada/

https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6277190/

India

https://twitter.com/martina_ant79/status/1385890869081948164

https://theprint.in/opinion/majority-indians-have-natural-immunity-vaccinating-entire-population-can-cause-great-harm/582174/

https://www.bmj.com/content/372/bmj.n196

https://twitter.com/YoureAllDunces/status/1386417031277252608

https://www.thelastamericanvagabond.com/norway-says-vaccine-risk-death-higher-than-covid-75-vaccine-deaths-in-india-within-3-days-of-jab/

https://twitter.com/_taylorhudak/status/1386095355352256519

https://theintercept.com/2021/04/23/covid-vaccine-ip-waiver-lobbying/

https://twitter.com/ElHombreRie/status/1386401597417091072

https://www.viralityproject.org/

https://www.cbsnews.com/news/moderna-covid-vaccine-booster-shots/

https://twitter.com/CRG_CRM/status/1385896304404959232