SloMo Train Wreck

SloMo Train Wreck

The wheels are falling off and we are watching a train wreck in slow motion.  The work of D.R.A.S.T.I.C and many others including McCairn, Rixey etc etc is starting to bear fruit.  The following material is inspired by an eight hour live stream from the McCairn Dojo.  Rather than edit such a long video I have highlighted some of the main stories.

 

 

DARPA comes across as the good guys (lolz)…..yeah…we believe you.  Wasn’t Malone’s research funded by DARPA?

Just after the hour Kevin shows another Veritas clip. Veritas Faggot bombs conservatives (lolz).  It does not take much to deconstruct this as pure propaganda meant to wind up conservative Christians.

CJD, Amyloid and K26R

CJD, Amyloid and K26R

The latest Kevin McCairn stream edited and split into three videos.  The first is a short video expanding on the topic from the previous video:  Global Prion Disease Treatment Market – Industry Trends and Forecast to 2028

Mad cows or crazy people? (5 mins)

Amyloid plaques (1 hour)

Resources

Presence of a SARS-CoV-2 Protein Enhances Amyloid Formation of Serum Amyloid A

GISAID Initiative

NCBI Sars CoV-2 Resources

Second entry looking for E-protein (envelope protein)

=====================
/product=”envelope protein”
/protein_id=”UBC57849.1″
/translation=”MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCC
NIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV”
=====================
Paste sequence in PLAAC:

MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV

PLAAC: Prion-Like Amino Acid Composition

Another paper on amyloid formation:

Interactions between SARS-CoV-2 N-protein and α-synuclein accelerate amyloid formation

 

ACE2 and the JEW: K26R to bind or not to bind that is the question? (15 min)

The following paper was published in Nature on 12 April 2021: Human ACE2 receptor polymorphism and altered susceptibility to SARS-CoV-2

"Among the variants tested, ACE2 K26R, consistent with its increased affinity for S-RBD observed in the biochemical assay, was the most effective (Ki 30 nM; ~33 fold greater than WT) in blocking viral entry (Fig. 5 and Table 1)".

"We also show that another ACE2 residue, K26, plays an important role in controlling the susceptibility to viral infections via a similar mechanism. Our structural analysis has suggested that K26R mutation will weaken coordination of the N90-linked glycan presumably interfering with its ability to shield the host from the viral infection. Our biochemical binding assays confirmed the predicted increased affinity for K26R ACE2 for S-protein. In fact, K26R ACE2 was the most effective among mutants tested for their ability to enhance viral entry, suggesting that this frequent polymorphism, very likely increases susceptibility to SARS-CoV-2 (Fig. 5 and Table 1)".

The above article in Nature says that K26R blocks the virus….in other words Ashkenazi Jews would be the most susceptible to covid. This goes completely contrary articles which state that the Jews are the least susceptible to covid such as this one: ACE2 coding variants in different populations and their potential impact on SARS-CoV-2 binding affinity. Look at the bar chart in the tweet below at the binding energy of K26R.

We also have another study that states;

Amish (AMI) and Ashkenazi Jewish (ASJ) populations do not appear to carry such variants in ACE2 coding regions (Fig. 1b). 
New insights into genetic susceptibility of COVID-19: an ACE2 and TMPRSS2 polymorphism analysis

So who is correct? A far as I am concerned anything published in Nature is suspect. The Indian author Somasekar Seshagiri works for Modmab Therapeutics Corporation is located in Foster City  California and  received a Coronavirus-related PPP loan from the SBA of $124,434.00 in April, 2020. Moreover, he went to the University of Georgia (in Athens, GA, US) where the Institute of Bioinformatics (founded 2002) with links to CDC has as director Jessica Kissinger.   Now Kissinger is an unusual name.  I am sure I heard it somewhere else (lolz).  Is she related to Henry?  Henry and his brother both have children and grand children. His mother (Mrs Kissinger) who died age 97 (Henry is 96 now)  was survived by two sons, as well as six grandchildren and six great-grandchildren.

These authors contributed equally: Kushal Suryamohan, Devan Diwanji, Eric W. Stawiski.
Cardiovascular Research Institute, University of California San Francisco.  The article they have just released was based on one that was written nearly exactly a year earlier (April 10, 2020). From memory this was about the time that the NYT posted an web article showing the complete genome sequence including 3D models of all the proteins.  The one released a year earlier Human ACE2 receptor polymorphisms predict SARS-CoV-2 susceptibility says something similar:

"....and thereby potentially alter host susceptibility. In particular, human ACE2 variants S19P, I21V, E23K, K26R, T27A, N64K, T92I, Q102P and H378R are predicted to increase susceptibility". 

It has many more authors (who seem to be have fallen away from this version): Eric W. Stawiski, Devan Diwanji, Kushal Suryamohan, Ravi Gupta, Frederic A. Fellouse, J. Fah Sathirapongsasuti, Jiang Liu, Ying-Ping Jiang, Aakrosh Ratan, Monika Mis, Devi Santhosh, Sneha Somasekar, Sangeetha Mohan, Sameer Phalke, Boney Kuriakose, Aju Antony, Jagath R. Junutula, Stephan C. Schuster, Natalia Jura, Somasekar Seshagiri.

This was a comment that I found under the article (the first one):

Comment: Ivan Shabalin

 
The paper describes an interesting idea, but the structural analysis and the predictions of the effects of the mutations are unsubstantiated and should be significantly revised.

For example, the presented analysis of the first mutation - K26R - has the following red flags:

- Figure 3b shows sugar labelled as "mannose", whereas the first sugar in glicosilated mammalian proteins should be N-acetylglucosamine (GlcNAc, or NAG), as it is in the crystal structures used for the analysis.

- The claim "We predict that K26R would abrogate stabilizing polar
contacts with N90, impairing coordination of the glycan (Figure 3b) and lead to an increase in the affinity of the virus to the ACE2 receptor" seems completely baseless. First, K and R are positively charged residues with similar lengths; I'm not convinced this mutation would necessarily abrogate the contact with NAG. Second, why would R form the predicted interaction with D-30? why not with Glu23, which is closer? Third, the following claim is very questionable "At the same time, R26 is now primed to establish backbone and side chain interactions with ACE2 D30 which then is poised to build a salt-bridge with CoV-2 RBD K417". In what way the proposed interaction R26-D30 would make D30 more prone to forming the salt bridge with K417? If anything, it would only decrease the strength of the bridge be being a "charge competitor". And, the salt bridge D30-K417 already exists in one of the structures they analyzed (6LZG).

Similarly, there are issues in the analysis of the second mutation:
- "The T27A mutant (Figure 3c) removes side chain-backbone and backbone-backbone interactions between T27 and E30 likely increasing the local dynamics of helix α1". First, there is a typo - it is E23. Second, the stability of a helix is mostly set by the C=O...N bonds between main-chain atoms, and the elimination of a side chain H-bond is unlikely to have a significant effect on the shape of the helix. Then, "This would allow the N-terminus of α1 to bend slightly and accommodate the unique CoV-2 RBD receptor binding-ridge loop that more intimately contacts ACE2 compared to its SARS-CoV counterpart" sounds very much unsubstantiated. To draw these conclusiong, MD simulations might need to be not perfomed.

Clearly, the analysis of other mutations is also questionable.

I believe that the Nature article is involved in a  cover up.

Ashkenazi Jews and the Amish people are related and they carry a similar polymorphism not just on ACE2 but other genes.   Moreover,  Jews are less susceptible to respiratory disease. The paragraph below  is from the blog article with the title:  Bio-war race targeting (McCairn1).

Ethnic Targeting

A number of questions come to my mind. In the paper discussed by Kevin the Jews and the Amish have a similar genetic polymorphism that protects them from Covid.  This means that  the Amish and the Jews are related. The history of the Amish church began with a schism in Switzerland within a group of Swiss and Alsatian Mennonite Anabaptists in 1693 led by Jakob Ammann. Those who followed Ammann became known as Amish. … In the early 18th century, many Amish and Mennonites immigrated to Pennsylvania for a variety of reasons. Not only do the Amish share a polymorphism with Ashkenazi Jews that makes them resistant to covid they share genetic loci for myopia (Fine-mapping of candidate region in Amish and Ashkenazi families confirms linkage of refractive error to a QTL on 1p34-p36). Anabaptists and Jews have had interactions for several centuries, since the origins of Anabaptism in the Radical Reformation in early modern Europe. Due to the insularity of many Anabaptist and Jewish communities, Anabaptist–Jewish relations have historically been limited but there are notable examples of interactions between Anabaptists and Jews. Due to some similarities in dress, culture, and language, Amish and Mennonite communities in particular have often been compared and contrasted to Hasidic Jewish communities (Wikipedia).The Mennonite Metzler family, tracing their lineage of descent through Valentine Metzler, a German immigrant who arrived in Lancaster County with his father Jacob in 1738, has close Y-DNA matches to Jewish families such as Kronik (in Belarus), Cohen and Langer (in Ukraine) and Friedman and Wengrowski (in Poland). [Anabaptisthistorians].  So, that solves that mystery. At some stage Ashkenazi Jews and Annabaptists must have interbred in Europe.

Not just  the study cited by Kevin but this one also presents a similar finding:

Here, we have analyzed the genetic markers of the TMPRSS2 gene and the differences in their alternative allele frequencies (AFs) among populations to identify possible susceptibility loci to COVID-19 and to correlate them with disease epidemiology. *AF= alternative allele frequencies (AFs). Regarding the non-synonymous pathogenic variants, we observed the highest AF among the Ashkenazi Jewish (ASJ) population (Figure 1A), while the Finnish (FIN) showed the highest AF among European subpopulations (Figure S2A). 
Genetic Analysis of the Coronavirus SARS-CoV-2 Host Protease TMPRSS2 in Different Populations

And this article from 2009:

DENVER — Researchers at National Jewish Health and the University of Colorado Denver have discovered a gene that is associated with improved survival among patients with acute lung injury. Acute lung injury (ALI) is often caused by a respiratory infection and results in low oxygen levels in the blood, and fluid in the lungs. It is one of the most vexing problems for intensive care units, afflicting almost 200,000 people in the United States each year, and killing 40 percent of them. https://www.nationaljewish.org/about/news/press-releases/2009/acute-lung-injury

And this paper:

The K26R (rs4646116) variant is an ACE2 variant that facilitates the binding of the S-glycoprotein effective in binding the coronavirus to the host cell and increases the susceptibility to the virus. The K26R variant, which reduces virus binding to the ACE2 receptor, has been found to be more concentrated in the Jewish population (1.2%) and, in contrast, the Asian population has the lowest allele frequency for the single nucleotide variant encoding K26R*

* Al-Mulla F, Mohammad A, Madhoun AA, Haddad D, Ali H, Eaaswarkhanth M, et al. A comprehensive germline variant and expression analyses of ACE2, TMPRSS2 and SARS-CoV-2 activator FURIN genes from the Middle East: Combating SARS-CoV-2 with precision medicine. bioRxiv 2020
Effects of Human Genetic Factors (Ethnicity and Race) on Clinical Severity of SARS-CoV-2 (COVID-19)Journal of Experimental and Basic Medical Sciences 2020;1(3):147-158

Scientific Collusion and Corruption

Scientific Collusion and Corruption

The following two videos are edited down from  14 hours of live-streaming.  The frustration of Dr Kevin McCairn is clearly apparent and the video comes with a language warning. These same  group of people continue their “natural origins” campaign unabated.  Their articles appear in Nature (as pre-prints) even although they are not peer reviewed.  They reference each other and self-reference.  Journals like Nature and the Lancet are captured.  People like Anderson (who initially suggested to Fauci that the virus look lab engineered)  got bought off with a grant.

Scientific Collusion and Corruption (part 1) 43 min

A two minute reminder (2 mins)

Daszak admits (see below) that some Chinese living near the bat caves have already developed natural immunity.  He also admits (talking about his work since the first pandemic in 2003) that coronavirus’ are easy to work with as you can use their “backbone” and insert sections etc.  He is talking about Gain Of Function. Not very smart is he?  And yet he wants us to believe that it is “natural”.

 

Like Kevin says…if the “bats” are such a problem send a drone with flame thrower into the bat caves and kill them all.   Of course…we all know that the bats are not the real problem it is the scientists who are playing with them and are receiving military funding.  This is dual use technology which is why they can get away with it. I wonder why Peter Darszak wants to blame Raccoon dogs?   Perhaps one of Kevin’s raccoons has bitten him?

 

 

 

These “scientists” have no shame.  They already have blood on their hands and they want to blame your intrusion into nature as the cause of the pandemic.   As long as they can continue to blame natural origin they can continue their lucrative funding and their dystopian plans to lock you up in a SMART city where they can continue surveilling you (for health reasons of course).

Scientific Collusion and Corruption (part 2) 34 min

Virology and Lie-ology

Virology and Lie-ology

The latest stream (7.5 hrs) from Dr Kevin McCairn I concentrated on his analysis of the following article, mainly because they are still insisting in the scientific journals like Nature and Lancet  on the blatant lie  that the virus is zoonotic.   They made and released a bio-weapon and are lying to your face.

 

 

Virology and Lie-ology (30 mins)

Ah, those were the days (lolz)

 

If you want to watch the full unedited version then join the Dojo: https://www.mccairndojo.com/

In the second part of the video Kevin analyzes the Eric Weinstein mea culpa which although it is a year old is quite funny.  Me thinketh he doth protest too much.

Eric Weinstein is the brother of Bret Weinstein. Eric Weinstein received his PhD in mathematical physics from Harvard University in 1992 under the supervision of Raoul Bott. In his dissertation, Extension of Self-Dual Yang-Mills Equations Across the Eighth Dimension, Weinstein showed that the self-dual Yang–Mills equations were not really peculiar to dimension four and admitted generalizations to higher dimensions. Weinstein left academia after stints at the Massachusetts Institute of Technology (Epstein was funding MIT projects) and the Hebrew University of Jerusalem. More than 20 years later, in 2013, he announced a potential unified theory of physics.

It is cringe worthy to watch. Everything from his dual citizenship, his links to Epstein his pathetic excuses. The only excuse he didn’t make was that of lawyer Alan Dershowitz (another Jew)….I kept my pants on during massages (lolz).  The girls involved were not minors (although very young) because this was Epstein’s NYC apartment.  His Caribbean  Island was another matter. The point is that all these scientific networks were involved with people like Epstein. They were all getting money from him.  Like Kevin says, perhaps Weinstein was innocent but he moved in those circles and must know people who were involved. Why has he not come forward?  Why has no one been arrested?  The whole system is utterly corrupt and they are covering for each other.

Go to the Dojo if you want to watch the analysis.   The point is not the guilt or otherwise of Weinstein who is scrabbling to distance himself.  The point is that all the systems are corrupt. Epstein had even hooked the Royals.   The take-away is …..how can you trust anything that comes out of these scientists mouths. This was the original monologue –

I didn’t do nuffin (lolz)

 

Gigaohm Biological (4 Sept)

Gigaohm Biological (4 Sept)

Highly Recommended — spread everywhere

Interviewing Jesse “Transhuman-phobic” Matchey from twitter (former Black-hawk Pilot) someone I follow because he is a great dot connector. I played this at 2.5x speed. At 38 minutes they are joined by Dr. Kevin McCairn. Good stuff big picture Geo-politics etc.

Update:  I was listening to this while putting together another page. Charles Rixey joins in just after the second hour.  He has done brilliant statistical work and gathered the raw data on a spreadsheet. What is happening is shocking.

If the sound does not work refresh the page, or go directly to the twitch page: https://www.twitch.tv/videos/1139235804

 

Are you a Nazi?

Are you a Nazi?

This website is not partisan.   I do not vote and never intend to vote.  I do not promote political movements but I do offer social commentary and expose hypocrisy.  So it is without any apologies that this is brought to your attention because we are treading a well worn path. It is the same path that was trodden before WW2.  The same people are behind it, using the same tactics to cause mayhem and bloodshed. 

Some might say that they lack imagination…can’t they think of something new?  Actually, they don’t need new strategies because people are dumb and they never seem to learn. They repeat the same mistakes.  If the pandemic has taught me anything, it has taught me how stupid people are.

The article was inspired by Dr Kevin McCairn being interviewed by David Hiscox a mild mannered middle-class Australian (in Victoria)  piano teacher and neo-Nazi (lolz).  Before we begin…if you answer yes to any of the below you are probably far-right, a terrorist or a Nazi:

  • Do you believe in stable families? 
  • Do you want Govt to leave you alone?
  • Do you believe in God?
  • Do you think good fences make good neighbors?
  • Are you sovereign over your own body?
  • Hard work leads to success?

I could add more to that list but if you answered yes to any of the above you are well on the way to becoming a terrorist.  You probably need to attend re-education camps.

Before we proceed any further I will offer my bona-fides and that of Dr Kevin M’cCairn.  People who know me know that I have mixed race children and so does Kevin (Japaneses/Pakistani). That can hardly qualify us as “racist” white supremacist bla, bla, bla. This is not about skin color but about culture, values and character.  The hypocrisy of the situation is that the Jews promoting  diversity and multiculturalism etc are the most inter-married, in-group, in-bred, group-preference people on earth.  They earnestly believe that they are superior and it is their due to rule the inferior races.  Never forget that it was white Christians who abolished the centuries old practice of slavery.

So, putting that to one side I was intrigued to learn that Kevin had been pilloried in the British Gutter Press for giving a 25 GBP donation to BNP (British National Party) which he did after Islamist’s hacked off the head of Lee Rigby in the middle of the street where he lived at the time. His academic career in the woke institutes took a nose dive after that incident.

I lived and worked in the UK for many years and loved West Yorkshire and the people. However, I saw it gradually deteriorate as areas became “ghettoized” causing “white flight” as people moved out of the urban areas in search of decent schools.  I saw the march of Common Purpose Marxism through the education system, the police and the judicial system.  I saw  Muslims practice child grooming and pedophilia rape gangs.  I saw the police turn a blind eye. It took years  and immense public pressure before arrests and prosecutions were made.  That is waaycist you see.  And this was to the detriment of decent law-abiding and upright Muslims that were my friends and work colleagues.  Everyone suffers when justice is not done, when “fictive reality” becomes the norm.

Did anyone ask why the UK was flooded with refugees?   Why Europe was flooded with refugees?   That was done on purpose.   They money men and the deep state shattered the Middle East to create Greater Israel and the Bridge and Road.   They knew that refugees would flood into Europe and destroy centuries of culture.  The great replacement had begun.  In order to build the MacKinder world Island they need to make you feel guilty over your ancestry.  You need to bow the knee because you are white.  Yet their race based weapon (Covid19)  targets whites and blacks (Ashkenazi Jews or Chinese to  a lesser extent).    They only care about themselves.  They are the only ones fit to rule the world.  It was promised to them.

White terrorists

How many of these “nationalists” groups have been penetrated by (very dumb) “intelligence assets”.  It is a well worn tactic.  The FBI does it all the time. They even recruit mentally retarded people and give them bomb -making material.   Ahaa….we caught them in the act.  How many of the atrocities that we see are staged false flag incidents?  We will never know but I no longer trust stories like the Christ Church shooting   which led to gun-confiscation laws just before the “pandemic”.    So many of these incidents are “false flag” operations.  How about Port Arthur?   I honestly don’t know but it is all so suspicious.

Meet the terrorist

David Hiscox is a middle class piano teacher who is trying to fight the great replacement. This is not about “white supremacy” but the fact that people want to be left alone to work and live and enjoy their own community. A nation is based on family.

"You either have a a strong patriarchy, you know strong families strong dedication to God and a strong nation or you have a globalist empire (battle one) or you have just chaos..."

One of the NSN (National Socialist Network) members (Dave Ryan)  drove a car and trailer around Adelaide with racist slogans and NSN stickers upsetting people. Channel Nine filmed the guy and 60 minutes did a hit piece on nationalists, racists Nazis, Jew hating white supremacists. Can you see what is happening?

It sounds to me a bit like what they did with Brendon O’Connell although Brendon was never a member of any group. 

I am not promoting David Hiscox but I think it is important to know both sides of the story.  To this end I place two articles warning everyone against the evil neo-Nazis.  Every word in these articles is true (sic).   So, I place both sides of the story below and also a link to their website.  I am a great believer in censoring nothing….especially when so many lies are being told.  I think that people who can think critically and do research should make up their own mind. 

But remember this…..extremism begets extremism…and unrighteousness begets unrighteousness…and lies begets lies…and those who live by the sword will die by the sword.  In God’s view we are all sinners.  No one is superior. The Jews (who were elect) got taught a powerful lesson when God brought Gentiles into covenant relationship.  They never got over it.

 

 

Make up your own mind

 

The website =  https://xyz.net.au/

The David Hiscox Show Ep. 11: With Dr. Kevin McCairn

 

See what I write in this article:

Right Wing Extremism

Debunking

Debunking

Dr McCairn debunks Dr Dan Watson natural origin fairy story. At this stage there are still people pushing the “natural origin” narrative.  With all the evidence that has emerged they no longer deserve to be given the benefit of the doubt.  In my view those who support proximal origins are  IIA (Interactive Internet Agents).   This video  is a cleaned up version (believe it or not) of  the stream and I added the ABC intro (Lolz).  The section about Chinese toilets is funny.  You have to laugh about something.

Debunking Da Funk of Dr. Dan Watson (1 hr 18mins)

Here is the original video.

Big Tech is the conspiracy (8 mins)

Censorship around the origins of covid. They don’t want you to know where it came from.

Covid Belt and Road (5 mins)

Dr Kevin McCairn looks at the geopolitics of the fall of Afghanistan

 

Here is an interesting thread on the origins (click and follow the thread):

 

Live Streaming With Billy Ray Valentine

Live Streaming With Billy Ray Valentine

Dividing society and promoting learned helplessness and obedience. We are going down the Marek disease pathway

 Aug 19, 2021 10:29 AM – 10:59 AM  (Part 1)

 

New frontier in health. Gene therapy by transfection tailored therapies at the end of a corporate needle. They need the data hence the experimentation. It supplements their transhumanist project. It is dual use technology.

Aug 19, 2021 11:03 AM – 11:44 AM (Part 2)

NASA Takes a Beating

NASA Takes a Beating

Yesterday Ben and the Suspicious Observers were indirectly attacked by NASA in a below par popular article which distorted and misrepresented the science around magnetic reversal.  They were arrogant, dismissive and wrong. In the next video Ben corrects their propaganda.

 

NASA's Article: https://climate.nasa.gov/blog/3104/fl... 

My Letter, "Geomagnetic Extinction": https://spaceweathernews.com/wp-conte...

Something about hundreds of papers? https://spaceweathernews.com/wp-conte...

8/11/2021 — Tsunami Warning + Large M7.1 Earthquake in West Pacific Philippines

Everything is influenced by Space Weather – especially earthquakes and volcanoes.