Vaccine Test

Vaccine Test

Second video very Important

The next two videos represent about 9 hours of live stream condensed down into shorter videos.  In the first video Kevin debunks some of the more outlandish claims made by people who investigate the vaccine using optical microscope.

In the second video Kevin uses his old microscope and a digital camera that his “Raccoons”  have funded…so that he is able to show live on screen in real time what he observes. Kevin was sent six vials of vaccines by his raccoons. Of course they were not kept in cold chain but that will make no difference to what is observed.

The results are shocking.  Not only does the vaccine contain contamination (which are not artifacts) but it looks to contain some sort of disk shaped nano particle (like the South African Doctor found)…but it gets worse…

When Kevin mixed a drop of his blood with the vaccine it “bleached” the blood. The Heme, or haem (spelling differences) which is a precursor to hemoglobin, which is necessary to bind oxygen in the bloodstream is effected.  

 

 

This is obviously a shocking result.  Kevin has also raised funds for a more powerful microscope and is going to perform more experiments in the coming Live-streams. Dr Kevin McCairn has contacted Dr Fleming the renowned Nuclear and Preventive Cardiologist and Kevin has also issued a warning.  He is trying to get the message out (see the interview on the Jimmy Gene show).  Kevin has been streaming for the last 36 hours – this is urgent.

Aliens in the vaccine (19 min)

Dr Kevin McCairn debunks some of the more outlandish speculations regarding the vaccine before obtaining some vials and deciding to test them himself (see other video).

 

Pfizer Vaccine Test (1 hour)

Dr Kevin McCairn performs an optical vaccine test during a live-stream using a microscope and digital camera. He mixes a drop of his blood with the vaccine and the results are shocking.

Dr Kevin McCairn performs an optical vaccine test during a live-stream using a microscope and digital camera. He mixes a drop of his blood with the vaccine and the results are shocking.

Jimmy Jean show discussion (3.5 hours)

 

Conclusion

This is serious and Kevin is Live Streaming again (I am watching as I type this).     The test is repeatable.   It is happening again as I watch.

Mitochondrial Damage

Mitochondrial Damage

Kevin analyses a scientific article from the Korea Brain Research Institute where he used to work (the first article in the tweet below).  The spike is cytopathic and degrades (among other things) mitochondrial cells. The second article is about how the spike induces  mitochondrial proton/electron leak and iron overload leading to cachexia, aging, endothelial and cardiovascular pathologies.    It does not look good especially if your mitochondria are already compromised.

 

Spike Proteins of Sars-CoV-2 induce Pathological Changes in Molecular Delivery and Metabolic Function in the Brain Endothelial Cells (27 min)

Brain Stimulation

Brain Stimulation

Nearly two hours uncut. Analysis of Closed-Loop neuromodulation in an individual with treatment-resistant depression interrupted by Kevin responding to the Live stream comments (language warning).  This is for people interested in deep brain stimulation etc which is Dr McCairns field of expertise it is not a stream about the current covid crisis (although there is an update on Amy Maxman at 1:25).

Patient Depressive State Modulated Via Deep Brain Stimulation (1:50 min)

Kevin Uncensored

Kevin Uncensored

Kevin is back after a three day break with a nearly four hour long stream which I do not have time to censor.  So I place a language warning and a running order with some important resources below the video. As Kevin says, “You have become untermensch in their system and they will do with you as they please”.

00:00 memes
14:00 Intro
23:00 OCTOBER 15 Why is this date constantly repeated?
30:00 Impulse control
45:00 China sends 77 warplanes into Taiwan
57:00 Body bags(good invesment)
59:00 Build Back batter Boris the psycho clown1:02 five eyes and wuhan
1:05 Medical system bolshevism
1:08 FBI at schools about CRT (Critical Race Theory)
1:15 Forced Sterilization
1:22 October 2019 Plandemic -Fauci-wokeism-sodomites
1:30 Mammon worshipers and sodomites
1:38 NYP and Mail Wuhan-Daszak-Farrar
1:42 Novel vaccine
1:48 Francis Collins -puff
1:51 Boergle – rant and lots of swearing “warning” (lolz)*
1:53 Barrister Alexander Macourts
1:55 Letter to Ecohealth Alliance board- overrun with deviants and scum
2:02 Peter Hotez
2:23 Making mistakes
2:27 Israel Tommy Robinson
2:34 Veritas
2:36 Dr Fleming
3:00 Memes (Break)
3:15 Funmax video from 2005- God gene

*Boergle is a patriotic South African Boer who remained after many others fled the country. He is sometimes called the librarian or the “prophet” (lolz) and is quite a character. He collects, scans and archives books about South African history before the history is rewritten. Before the white man arrived the Zulu’s enslaved the Hottentots. When the Dutch farmers arrived and made the great “trek” from the cape the hinterland which they turned into productive farmland and built a nation. Trekking began as early as 1700. The Zulu formed a powerful state in 1816 under the leader Shaka.The Battle of Rorke’s Drift (1879), also known as the Defence of Rorke’s Drift, was a British  engagement in the Anglo-Zulu War (see the movie Zulu). Although the Dutch had some run-ins with the Xhosa the main problem was with the British. Boergle tells how Johannesburg became know as Jew-hannesburg as they moved in and corrupted the morals and the political trouble started.  The Bolsheviks agitated and Mandela was trained by Mossad. The ANC was internationalist (communist) from its inception.  The rant is when Boergle receives a letter mandating the (Cuban) vaccine.  Boergle is “strapped” and has defended his property from incursions before.

 

Dr Fleming and Alex Jones

Dr Kevin McCairn and Dr Fleming are well aware of Alex Jones’ background etc.  but are trying to get the message as circulated as widely as possible and Alex Jones has a huge audience. Dr Fleming is one of the good guys and is pursuing the ICC case.  Please sign the petition.

Emergency Saturday Broadcast Pentagon AI Confirms Covid Shots Triggering Deadly ADE in the Vaccine (3hrs)

Funvax

Funvx or Fundamentalist vax has been highlighted by this blog before in connection with the “God gene”. Where did the Redacted Quarterly FunVax Review (2007) come from? Who leaked it? I don’t know, but page 5 mentions a CA facility in San Diego and reckon it could be The Neurosciences Institute, which ticks all the right boxes for me. It was an NGO (nonprofit) linked to Rockefeller University in New York City.In 1993, following its relocation to San Diego, NSI added a program of experimental research, which would eventually include molecular, cellular, systems, and behavioral studies and would utilize flies, rodents, non-human primates, and humans.

It sounds like science fiction but I found these relevant articles:

Selective Knockout of the Vesicular Monoamine Transporter 2 (Vmat2) Gene in Calbindin2/Calretinin-Positive Neurons Results in Profound Changes in Behavior and Response to Drugs of Abuse conditional knockout (cKO) strategies based on neurotransmitter phenotype (2020)

"Several of the knockout mouse lines generated to genetically target Vmat2 preclude behavioral studies, as these transgenic models are so severely affected during development that offspring do not survive into adulthood (Takahashi et al., 1997; Wang et al., 1997; Isingrini et al., 2016b)". 
https://www.frontiersin.org/articles/10.3389/fnbeh.2020.578443/full

Which refers to the 1997 paper by Wang, so they were busy with this sort of research long before 2007. The problem about alcohol as an inhibitor may be related to this article Sex-Dependent Modulation of Ethanol Consumption in Vesicular Monoamine Transporter 2 (VMAT2) and Dopamine Transporter (DAT) Knockout Mice (2003). And finally Vesicular Stomatitis Virus (VSV) can be used like a bullet for targeting.  It all sounds very plausible and deeply psychotic.  We live in dark times.  Below is a presentation that I found which includes Adrenochrome.

Vmat2, FunVax Vaccine and Adrenochrome – a tentative investigation from uniquelee

 

And this fun video about Vmat 2  (3 min)

Notification: Petition

Notification: Petition

This is an appeal to sign the petition.   I have signed and paid for promotion (you don’t need to pay just sign).

Dr Flemming and Dr Kevin McCairn and many others already have a case number at the International Criminal Court in the Hague.  A crime has been committed against humanity…a war crime.    The only way to fight this is with the truth. All our institutions are corrupt and most of our politicians.  Will this court case be successful?    I doubt it very much (and so does Kevin).  However, we need to get this on the record as a witness and the more signatures we achieve the more difficult it will be to ignore.  Crimes have been committed and they need investigating and prosecuting.

If you don’t stand up for truth who will?   In the end we know there is only one Truth and that is Jesus Christ but that does not absolve us from speaking out and exposing the wrong doing.

Sign the petition

 

The Big Lie

Sachs and EcoHealth

Sachs and EcoHealth

The full live-stream was nearly six hours and  I place it here unedited (language warning) with a running order.

  • 0:00 Memes (skip these)
  • 16:40 Intro Jeffrey Sachs distancing himself from EcoHealth (see 1:42)
  • 23:00 Mark from Housatonic discusses Trevor Bradfield and West Nile Virus
  • 46:00 Florida surgeon general opposes mandates Kev discusses bio-warfare
  • 55:00 Rochelle P. Walensky director of CDC
  • 1.00  Mark about statistics
  • 1:08 psychopathy
  • 1:13 Gaming statistics, if you die within two weeks of vaxx you count as UNVACCINATED
  • 1:34 Veritas
  • 1:37 Malone and Gert pushing a new therapy (sellouts?)
  • 1.42 Jeffrey Sachs distancing himself from EcoHealth.  Sachs is a globalist who helped create the oligarch class in Russia after the wall came down
  • 2:44 Brigade Surgeons Affidavit investigated
  • 3:40 Arnab debate between India and Pakistan. India has a new ICBM with a range of  5,000 km and Modi is visiting the USA. This is worrying for China and their ally Pakistan.

 

 

Comments and Resources:

Sachs is like a rat leaving a sinking ship.  This shows that the work that DRASTIC, Kevin,Rixey et al are doing is being effective.  The bombs are on target.  India is emerging as a regional super power. The debate was both funny and frightening. Imagine some of these people with their finger on the nuclear button.

One minute short:

 

SloMo Train Wreck

SloMo Train Wreck

The wheels are falling off and we are watching a train wreck in slow motion.  The work of D.R.A.S.T.I.C and many others including McCairn, Rixey etc etc is starting to bear fruit.  The following material is inspired by an eight hour live stream from the McCairn Dojo.  Rather than edit such a long video I have highlighted some of the main stories.

 

 

DARPA comes across as the good guys (lolz)…..yeah…we believe you.  Wasn’t Malone’s research funded by DARPA?

Just after the hour Kevin shows another Veritas clip. Veritas Faggot bombs conservatives (lolz).  It does not take much to deconstruct this as pure propaganda meant to wind up conservative Christians.

CJD, Amyloid and K26R

CJD, Amyloid and K26R

The latest Kevin McCairn stream edited and split into three videos.  The first is a short video expanding on the topic from the previous video:  Global Prion Disease Treatment Market – Industry Trends and Forecast to 2028

Mad cows or crazy people? (5 mins)

Amyloid plaques (1 hour)

Resources

Presence of a SARS-CoV-2 Protein Enhances Amyloid Formation of Serum Amyloid A

GISAID Initiative

NCBI Sars CoV-2 Resources

Second entry looking for E-protein (envelope protein)

=====================
/product=”envelope protein”
/protein_id=”UBC57849.1″
/translation=”MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCC
NIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV”
=====================
Paste sequence in PLAAC:

MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV

PLAAC: Prion-Like Amino Acid Composition

Another paper on amyloid formation:

Interactions between SARS-CoV-2 N-protein and α-synuclein accelerate amyloid formation

 

ACE2 and the JEW: K26R to bind or not to bind that is the question? (15 min)

The following paper was published in Nature on 12 April 2021: Human ACE2 receptor polymorphism and altered susceptibility to SARS-CoV-2

"Among the variants tested, ACE2 K26R, consistent with its increased affinity for S-RBD observed in the biochemical assay, was the most effective (Ki 30 nM; ~33 fold greater than WT) in blocking viral entry (Fig. 5 and Table 1)".

"We also show that another ACE2 residue, K26, plays an important role in controlling the susceptibility to viral infections via a similar mechanism. Our structural analysis has suggested that K26R mutation will weaken coordination of the N90-linked glycan presumably interfering with its ability to shield the host from the viral infection. Our biochemical binding assays confirmed the predicted increased affinity for K26R ACE2 for S-protein. In fact, K26R ACE2 was the most effective among mutants tested for their ability to enhance viral entry, suggesting that this frequent polymorphism, very likely increases susceptibility to SARS-CoV-2 (Fig. 5 and Table 1)".

The above article in Nature says that K26R blocks the virus….in other words Ashkenazi Jews would be the most susceptible to covid. This goes completely contrary articles which state that the Jews are the least susceptible to covid such as this one: ACE2 coding variants in different populations and their potential impact on SARS-CoV-2 binding affinity. Look at the bar chart in the tweet below at the binding energy of K26R.

We also have another study that states;

Amish (AMI) and Ashkenazi Jewish (ASJ) populations do not appear to carry such variants in ACE2 coding regions (Fig. 1b). 
New insights into genetic susceptibility of COVID-19: an ACE2 and TMPRSS2 polymorphism analysis

So who is correct? A far as I am concerned anything published in Nature is suspect. The Indian author Somasekar Seshagiri works for Modmab Therapeutics Corporation is located in Foster City  California and  received a Coronavirus-related PPP loan from the SBA of $124,434.00 in April, 2020. Moreover, he went to the University of Georgia (in Athens, GA, US) where the Institute of Bioinformatics (founded 2002) with links to CDC has as director Jessica Kissinger.   Now Kissinger is an unusual name.  I am sure I heard it somewhere else (lolz).  Is she related to Henry?  Henry and his brother both have children and grand children. His mother (Mrs Kissinger) who died age 97 (Henry is 96 now)  was survived by two sons, as well as six grandchildren and six great-grandchildren.

These authors contributed equally: Kushal Suryamohan, Devan Diwanji, Eric W. Stawiski.
Cardiovascular Research Institute, University of California San Francisco.  The article they have just released was based on one that was written nearly exactly a year earlier (April 10, 2020). From memory this was about the time that the NYT posted an web article showing the complete genome sequence including 3D models of all the proteins.  The one released a year earlier Human ACE2 receptor polymorphisms predict SARS-CoV-2 susceptibility says something similar:

"....and thereby potentially alter host susceptibility. In particular, human ACE2 variants S19P, I21V, E23K, K26R, T27A, N64K, T92I, Q102P and H378R are predicted to increase susceptibility". 

It has many more authors (who seem to be have fallen away from this version): Eric W. Stawiski, Devan Diwanji, Kushal Suryamohan, Ravi Gupta, Frederic A. Fellouse, J. Fah Sathirapongsasuti, Jiang Liu, Ying-Ping Jiang, Aakrosh Ratan, Monika Mis, Devi Santhosh, Sneha Somasekar, Sangeetha Mohan, Sameer Phalke, Boney Kuriakose, Aju Antony, Jagath R. Junutula, Stephan C. Schuster, Natalia Jura, Somasekar Seshagiri.

This was a comment that I found under the article (the first one):

Comment: Ivan Shabalin

 
The paper describes an interesting idea, but the structural analysis and the predictions of the effects of the mutations are unsubstantiated and should be significantly revised.

For example, the presented analysis of the first mutation - K26R - has the following red flags:

- Figure 3b shows sugar labelled as "mannose", whereas the first sugar in glicosilated mammalian proteins should be N-acetylglucosamine (GlcNAc, or NAG), as it is in the crystal structures used for the analysis.

- The claim "We predict that K26R would abrogate stabilizing polar
contacts with N90, impairing coordination of the glycan (Figure 3b) and lead to an increase in the affinity of the virus to the ACE2 receptor" seems completely baseless. First, K and R are positively charged residues with similar lengths; I'm not convinced this mutation would necessarily abrogate the contact with NAG. Second, why would R form the predicted interaction with D-30? why not with Glu23, which is closer? Third, the following claim is very questionable "At the same time, R26 is now primed to establish backbone and side chain interactions with ACE2 D30 which then is poised to build a salt-bridge with CoV-2 RBD K417". In what way the proposed interaction R26-D30 would make D30 more prone to forming the salt bridge with K417? If anything, it would only decrease the strength of the bridge be being a "charge competitor". And, the salt bridge D30-K417 already exists in one of the structures they analyzed (6LZG).

Similarly, there are issues in the analysis of the second mutation:
- "The T27A mutant (Figure 3c) removes side chain-backbone and backbone-backbone interactions between T27 and E30 likely increasing the local dynamics of helix α1". First, there is a typo - it is E23. Second, the stability of a helix is mostly set by the C=O...N bonds between main-chain atoms, and the elimination of a side chain H-bond is unlikely to have a significant effect on the shape of the helix. Then, "This would allow the N-terminus of α1 to bend slightly and accommodate the unique CoV-2 RBD receptor binding-ridge loop that more intimately contacts ACE2 compared to its SARS-CoV counterpart" sounds very much unsubstantiated. To draw these conclusiong, MD simulations might need to be not perfomed.

Clearly, the analysis of other mutations is also questionable.

I believe that the Nature article is involved in a  cover up.

Ashkenazi Jews and the Amish people are related and they carry a similar polymorphism not just on ACE2 but other genes.   Moreover,  Jews are less susceptible to respiratory disease. The paragraph below  is from the blog article with the title:  Bio-war race targeting (McCairn1).

Ethnic Targeting

A number of questions come to my mind. In the paper discussed by Kevin the Jews and the Amish have a similar genetic polymorphism that protects them from Covid.  This means that  the Amish and the Jews are related. The history of the Amish church began with a schism in Switzerland within a group of Swiss and Alsatian Mennonite Anabaptists in 1693 led by Jakob Ammann. Those who followed Ammann became known as Amish. … In the early 18th century, many Amish and Mennonites immigrated to Pennsylvania for a variety of reasons. Not only do the Amish share a polymorphism with Ashkenazi Jews that makes them resistant to covid they share genetic loci for myopia (Fine-mapping of candidate region in Amish and Ashkenazi families confirms linkage of refractive error to a QTL on 1p34-p36). Anabaptists and Jews have had interactions for several centuries, since the origins of Anabaptism in the Radical Reformation in early modern Europe. Due to the insularity of many Anabaptist and Jewish communities, Anabaptist–Jewish relations have historically been limited but there are notable examples of interactions between Anabaptists and Jews. Due to some similarities in dress, culture, and language, Amish and Mennonite communities in particular have often been compared and contrasted to Hasidic Jewish communities (Wikipedia).The Mennonite Metzler family, tracing their lineage of descent through Valentine Metzler, a German immigrant who arrived in Lancaster County with his father Jacob in 1738, has close Y-DNA matches to Jewish families such as Kronik (in Belarus), Cohen and Langer (in Ukraine) and Friedman and Wengrowski (in Poland). [Anabaptisthistorians].  So, that solves that mystery. At some stage Ashkenazi Jews and Annabaptists must have interbred in Europe.

Not just  the study cited by Kevin but this one also presents a similar finding:

Here, we have analyzed the genetic markers of the TMPRSS2 gene and the differences in their alternative allele frequencies (AFs) among populations to identify possible susceptibility loci to COVID-19 and to correlate them with disease epidemiology. *AF= alternative allele frequencies (AFs). Regarding the non-synonymous pathogenic variants, we observed the highest AF among the Ashkenazi Jewish (ASJ) population (Figure 1A), while the Finnish (FIN) showed the highest AF among European subpopulations (Figure S2A). 
Genetic Analysis of the Coronavirus SARS-CoV-2 Host Protease TMPRSS2 in Different Populations

And this article from 2009:

DENVER — Researchers at National Jewish Health and the University of Colorado Denver have discovered a gene that is associated with improved survival among patients with acute lung injury. Acute lung injury (ALI) is often caused by a respiratory infection and results in low oxygen levels in the blood, and fluid in the lungs. It is one of the most vexing problems for intensive care units, afflicting almost 200,000 people in the United States each year, and killing 40 percent of them. https://www.nationaljewish.org/about/news/press-releases/2009/acute-lung-injury

And this paper:

The K26R (rs4646116) variant is an ACE2 variant that facilitates the binding of the S-glycoprotein effective in binding the coronavirus to the host cell and increases the susceptibility to the virus. The K26R variant, which reduces virus binding to the ACE2 receptor, has been found to be more concentrated in the Jewish population (1.2%) and, in contrast, the Asian population has the lowest allele frequency for the single nucleotide variant encoding K26R*

* Al-Mulla F, Mohammad A, Madhoun AA, Haddad D, Ali H, Eaaswarkhanth M, et al. A comprehensive germline variant and expression analyses of ACE2, TMPRSS2 and SARS-CoV-2 activator FURIN genes from the Middle East: Combating SARS-CoV-2 with precision medicine. bioRxiv 2020
Effects of Human Genetic Factors (Ethnicity and Race) on Clinical Severity of SARS-CoV-2 (COVID-19)Journal of Experimental and Basic Medical Sciences 2020;1(3):147-158

Scientific Collusion and Corruption

Scientific Collusion and Corruption

The following two videos are edited down from  14 hours of live-streaming.  The frustration of Dr Kevin McCairn is clearly apparent and the video comes with a language warning. These same  group of people continue their “natural origins” campaign unabated.  Their articles appear in Nature (as pre-prints) even although they are not peer reviewed.  They reference each other and self-reference.  Journals like Nature and the Lancet are captured.  People like Anderson (who initially suggested to Fauci that the virus look lab engineered)  got bought off with a grant.

Scientific Collusion and Corruption (part 1) 43 min

A two minute reminder (2 mins)

Daszak admits (see below) that some Chinese living near the bat caves have already developed natural immunity.  He also admits (talking about his work since the first pandemic in 2003) that coronavirus’ are easy to work with as you can use their “backbone” and insert sections etc.  He is talking about Gain Of Function. Not very smart is he?  And yet he wants us to believe that it is “natural”.

 

Like Kevin says…if the “bats” are such a problem send a drone with flame thrower into the bat caves and kill them all.   Of course…we all know that the bats are not the real problem it is the scientists who are playing with them and are receiving military funding.  This is dual use technology which is why they can get away with it. I wonder why Peter Darszak wants to blame Raccoon dogs?   Perhaps one of Kevin’s raccoons has bitten him?

 

 

 

These “scientists” have no shame.  They already have blood on their hands and they want to blame your intrusion into nature as the cause of the pandemic.   As long as they can continue to blame natural origin they can continue their lucrative funding and their dystopian plans to lock you up in a SMART city where they can continue surveilling you (for health reasons of course).

Scientific Collusion and Corruption (part 2) 34 min

Virology and Lie-ology

Virology and Lie-ology

The latest stream (7.5 hrs) from Dr Kevin McCairn I concentrated on his analysis of the following article, mainly because they are still insisting in the scientific journals like Nature and Lancet  on the blatant lie  that the virus is zoonotic.   They made and released a bio-weapon and are lying to your face.

 

 

Virology and Lie-ology (30 mins)

Ah, those were the days (lolz)

 

If you want to watch the full unedited version then join the Dojo: https://www.mccairndojo.com/

In the second part of the video Kevin analyzes the Eric Weinstein mea culpa which although it is a year old is quite funny.  Me thinketh he doth protest too much.

Eric Weinstein is the brother of Bret Weinstein. Eric Weinstein received his PhD in mathematical physics from Harvard University in 1992 under the supervision of Raoul Bott. In his dissertation, Extension of Self-Dual Yang-Mills Equations Across the Eighth Dimension, Weinstein showed that the self-dual Yang–Mills equations were not really peculiar to dimension four and admitted generalizations to higher dimensions. Weinstein left academia after stints at the Massachusetts Institute of Technology (Epstein was funding MIT projects) and the Hebrew University of Jerusalem. More than 20 years later, in 2013, he announced a potential unified theory of physics.

It is cringe worthy to watch. Everything from his dual citizenship, his links to Epstein his pathetic excuses. The only excuse he didn’t make was that of lawyer Alan Dershowitz (another Jew)….I kept my pants on during massages (lolz).  The girls involved were not minors (although very young) because this was Epstein’s NYC apartment.  His Caribbean  Island was another matter. The point is that all these scientific networks were involved with people like Epstein. They were all getting money from him.  Like Kevin says, perhaps Weinstein was innocent but he moved in those circles and must know people who were involved. Why has he not come forward?  Why has no one been arrested?  The whole system is utterly corrupt and they are covering for each other.

Go to the Dojo if you want to watch the analysis.   The point is not the guilt or otherwise of Weinstein who is scrabbling to distance himself.  The point is that all the systems are corrupt. Epstein had even hooked the Royals.   The take-away is …..how can you trust anything that comes out of these scientists mouths. This was the original monologue –

I didn’t do nuffin (lolz)