Roots

Roots

Stay true to your roots.

 

As Kevin would say…..

                                                        …..the Jew always comes thru…

CJD, Amyloid and K26R

CJD, Amyloid and K26R

The latest Kevin McCairn stream edited and split into three videos.  The first is a short video expanding on the topic from the previous video:  Global Prion Disease Treatment Market – Industry Trends and Forecast to 2028

Mad cows or crazy people? (5 mins)

Amyloid plaques (1 hour)

Resources

Presence of a SARS-CoV-2 Protein Enhances Amyloid Formation of Serum Amyloid A

GISAID Initiative

NCBI Sars CoV-2 Resources

Second entry looking for E-protein (envelope protein)

=====================
/product=”envelope protein”
/protein_id=”UBC57849.1″
/translation=”MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCC
NIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV”
=====================
Paste sequence in PLAAC:

MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV

PLAAC: Prion-Like Amino Acid Composition

Another paper on amyloid formation:

Interactions between SARS-CoV-2 N-protein and α-synuclein accelerate amyloid formation

 

ACE2 and the JEW: K26R to bind or not to bind that is the question? (15 min)

The following paper was published in Nature on 12 April 2021: Human ACE2 receptor polymorphism and altered susceptibility to SARS-CoV-2

"Among the variants tested, ACE2 K26R, consistent with its increased affinity for S-RBD observed in the biochemical assay, was the most effective (Ki 30 nM; ~33 fold greater than WT) in blocking viral entry (Fig. 5 and Table 1)".

"We also show that another ACE2 residue, K26, plays an important role in controlling the susceptibility to viral infections via a similar mechanism. Our structural analysis has suggested that K26R mutation will weaken coordination of the N90-linked glycan presumably interfering with its ability to shield the host from the viral infection. Our biochemical binding assays confirmed the predicted increased affinity for K26R ACE2 for S-protein. In fact, K26R ACE2 was the most effective among mutants tested for their ability to enhance viral entry, suggesting that this frequent polymorphism, very likely increases susceptibility to SARS-CoV-2 (Fig. 5 and Table 1)".

The above article in Nature says that K26R blocks the virus….in other words Ashkenazi Jews would be the most susceptible to covid. This goes completely contrary articles which state that the Jews are the least susceptible to covid such as this one: ACE2 coding variants in different populations and their potential impact on SARS-CoV-2 binding affinity. Look at the bar chart in the tweet below at the binding energy of K26R.

We also have another study that states;

Amish (AMI) and Ashkenazi Jewish (ASJ) populations do not appear to carry such variants in ACE2 coding regions (Fig. 1b). 
New insights into genetic susceptibility of COVID-19: an ACE2 and TMPRSS2 polymorphism analysis

So who is correct? A far as I am concerned anything published in Nature is suspect. The Indian author Somasekar Seshagiri works for Modmab Therapeutics Corporation is located in Foster City  California and  received a Coronavirus-related PPP loan from the SBA of $124,434.00 in April, 2020. Moreover, he went to the University of Georgia (in Athens, GA, US) where the Institute of Bioinformatics (founded 2002) with links to CDC has as director Jessica Kissinger.   Now Kissinger is an unusual name.  I am sure I heard it somewhere else (lolz).  Is she related to Henry?  Henry and his brother both have children and grand children. His mother (Mrs Kissinger) who died age 97 (Henry is 96 now)  was survived by two sons, as well as six grandchildren and six great-grandchildren.

These authors contributed equally: Kushal Suryamohan, Devan Diwanji, Eric W. Stawiski.
Cardiovascular Research Institute, University of California San Francisco.  The article they have just released was based on one that was written nearly exactly a year earlier (April 10, 2020). From memory this was about the time that the NYT posted an web article showing the complete genome sequence including 3D models of all the proteins.  The one released a year earlier Human ACE2 receptor polymorphisms predict SARS-CoV-2 susceptibility says something similar:

"....and thereby potentially alter host susceptibility. In particular, human ACE2 variants S19P, I21V, E23K, K26R, T27A, N64K, T92I, Q102P and H378R are predicted to increase susceptibility". 

It has many more authors (who seem to be have fallen away from this version): Eric W. Stawiski, Devan Diwanji, Kushal Suryamohan, Ravi Gupta, Frederic A. Fellouse, J. Fah Sathirapongsasuti, Jiang Liu, Ying-Ping Jiang, Aakrosh Ratan, Monika Mis, Devi Santhosh, Sneha Somasekar, Sangeetha Mohan, Sameer Phalke, Boney Kuriakose, Aju Antony, Jagath R. Junutula, Stephan C. Schuster, Natalia Jura, Somasekar Seshagiri.

This was a comment that I found under the article (the first one):

Comment: Ivan Shabalin

 
The paper describes an interesting idea, but the structural analysis and the predictions of the effects of the mutations are unsubstantiated and should be significantly revised.

For example, the presented analysis of the first mutation - K26R - has the following red flags:

- Figure 3b shows sugar labelled as "mannose", whereas the first sugar in glicosilated mammalian proteins should be N-acetylglucosamine (GlcNAc, or NAG), as it is in the crystal structures used for the analysis.

- The claim "We predict that K26R would abrogate stabilizing polar
contacts with N90, impairing coordination of the glycan (Figure 3b) and lead to an increase in the affinity of the virus to the ACE2 receptor" seems completely baseless. First, K and R are positively charged residues with similar lengths; I'm not convinced this mutation would necessarily abrogate the contact with NAG. Second, why would R form the predicted interaction with D-30? why not with Glu23, which is closer? Third, the following claim is very questionable "At the same time, R26 is now primed to establish backbone and side chain interactions with ACE2 D30 which then is poised to build a salt-bridge with CoV-2 RBD K417". In what way the proposed interaction R26-D30 would make D30 more prone to forming the salt bridge with K417? If anything, it would only decrease the strength of the bridge be being a "charge competitor". And, the salt bridge D30-K417 already exists in one of the structures they analyzed (6LZG).

Similarly, there are issues in the analysis of the second mutation:
- "The T27A mutant (Figure 3c) removes side chain-backbone and backbone-backbone interactions between T27 and E30 likely increasing the local dynamics of helix α1". First, there is a typo - it is E23. Second, the stability of a helix is mostly set by the C=O...N bonds between main-chain atoms, and the elimination of a side chain H-bond is unlikely to have a significant effect on the shape of the helix. Then, "This would allow the N-terminus of α1 to bend slightly and accommodate the unique CoV-2 RBD receptor binding-ridge loop that more intimately contacts ACE2 compared to its SARS-CoV counterpart" sounds very much unsubstantiated. To draw these conclusiong, MD simulations might need to be not perfomed.

Clearly, the analysis of other mutations is also questionable.

I believe that the Nature article is involved in a  cover up.

Ashkenazi Jews and the Amish people are related and they carry a similar polymorphism not just on ACE2 but other genes.   Moreover,  Jews are less susceptible to respiratory disease. The paragraph below  is from the blog article with the title:  Bio-war race targeting (McCairn1).

Ethnic Targeting

A number of questions come to my mind. In the paper discussed by Kevin the Jews and the Amish have a similar genetic polymorphism that protects them from Covid.  This means that  the Amish and the Jews are related. The history of the Amish church began with a schism in Switzerland within a group of Swiss and Alsatian Mennonite Anabaptists in 1693 led by Jakob Ammann. Those who followed Ammann became known as Amish. … In the early 18th century, many Amish and Mennonites immigrated to Pennsylvania for a variety of reasons. Not only do the Amish share a polymorphism with Ashkenazi Jews that makes them resistant to covid they share genetic loci for myopia (Fine-mapping of candidate region in Amish and Ashkenazi families confirms linkage of refractive error to a QTL on 1p34-p36). Anabaptists and Jews have had interactions for several centuries, since the origins of Anabaptism in the Radical Reformation in early modern Europe. Due to the insularity of many Anabaptist and Jewish communities, Anabaptist–Jewish relations have historically been limited but there are notable examples of interactions between Anabaptists and Jews. Due to some similarities in dress, culture, and language, Amish and Mennonite communities in particular have often been compared and contrasted to Hasidic Jewish communities (Wikipedia).The Mennonite Metzler family, tracing their lineage of descent through Valentine Metzler, a German immigrant who arrived in Lancaster County with his father Jacob in 1738, has close Y-DNA matches to Jewish families such as Kronik (in Belarus), Cohen and Langer (in Ukraine) and Friedman and Wengrowski (in Poland). [Anabaptisthistorians].  So, that solves that mystery. At some stage Ashkenazi Jews and Annabaptists must have interbred in Europe.

Not just  the study cited by Kevin but this one also presents a similar finding:

Here, we have analyzed the genetic markers of the TMPRSS2 gene and the differences in their alternative allele frequencies (AFs) among populations to identify possible susceptibility loci to COVID-19 and to correlate them with disease epidemiology. *AF= alternative allele frequencies (AFs). Regarding the non-synonymous pathogenic variants, we observed the highest AF among the Ashkenazi Jewish (ASJ) population (Figure 1A), while the Finnish (FIN) showed the highest AF among European subpopulations (Figure S2A). 
Genetic Analysis of the Coronavirus SARS-CoV-2 Host Protease TMPRSS2 in Different Populations

And this article from 2009:

DENVER — Researchers at National Jewish Health and the University of Colorado Denver have discovered a gene that is associated with improved survival among patients with acute lung injury. Acute lung injury (ALI) is often caused by a respiratory infection and results in low oxygen levels in the blood, and fluid in the lungs. It is one of the most vexing problems for intensive care units, afflicting almost 200,000 people in the United States each year, and killing 40 percent of them. https://www.nationaljewish.org/about/news/press-releases/2009/acute-lung-injury

And this paper:

The K26R (rs4646116) variant is an ACE2 variant that facilitates the binding of the S-glycoprotein effective in binding the coronavirus to the host cell and increases the susceptibility to the virus. The K26R variant, which reduces virus binding to the ACE2 receptor, has been found to be more concentrated in the Jewish population (1.2%) and, in contrast, the Asian population has the lowest allele frequency for the single nucleotide variant encoding K26R*

* Al-Mulla F, Mohammad A, Madhoun AA, Haddad D, Ali H, Eaaswarkhanth M, et al. A comprehensive germline variant and expression analyses of ACE2, TMPRSS2 and SARS-CoV-2 activator FURIN genes from the Middle East: Combating SARS-CoV-2 with precision medicine. bioRxiv 2020
Effects of Human Genetic Factors (Ethnicity and Race) on Clinical Severity of SARS-CoV-2 (COVID-19)Journal of Experimental and Basic Medical Sciences 2020;1(3):147-158

Are you a Nazi?

Are you a Nazi?

This website is not partisan.   I do not vote and never intend to vote.  I do not promote political movements but I do offer social commentary and expose hypocrisy.  So it is without any apologies that this is brought to your attention because we are treading a well worn path. It is the same path that was trodden before WW2.  The same people are behind it, using the same tactics to cause mayhem and bloodshed. 

Some might say that they lack imagination…can’t they think of something new?  Actually, they don’t need new strategies because people are dumb and they never seem to learn. They repeat the same mistakes.  If the pandemic has taught me anything, it has taught me how stupid people are.

The article was inspired by Dr Kevin McCairn being interviewed by David Hiscox a mild mannered middle-class Australian (in Victoria)  piano teacher and neo-Nazi (lolz).  Before we begin…if you answer yes to any of the below you are probably far-right, a terrorist or a Nazi:

  • Do you believe in stable families? 
  • Do you want Govt to leave you alone?
  • Do you believe in God?
  • Do you think good fences make good neighbors?
  • Are you sovereign over your own body?
  • Hard work leads to success?

I could add more to that list but if you answered yes to any of the above you are well on the way to becoming a terrorist.  You probably need to attend re-education camps.

Before we proceed any further I will offer my bona-fides and that of Dr Kevin M’cCairn.  People who know me know that I have mixed race children and so does Kevin (Japaneses/Pakistani). That can hardly qualify us as “racist” white supremacist bla, bla, bla. This is not about skin color but about culture, values and character.  The hypocrisy of the situation is that the Jews promoting  diversity and multiculturalism etc are the most inter-married, in-group, in-bred, group-preference people on earth.  They earnestly believe that they are superior and it is their due to rule the inferior races.  Never forget that it was white Christians who abolished the centuries old practice of slavery.

So, putting that to one side I was intrigued to learn that Kevin had been pilloried in the British Gutter Press for giving a 25 GBP donation to BNP (British National Party) which he did after Islamist’s hacked off the head of Lee Rigby in the middle of the street where he lived at the time. His academic career in the woke institutes took a nose dive after that incident.

I lived and worked in the UK for many years and loved West Yorkshire and the people. However, I saw it gradually deteriorate as areas became “ghettoized” causing “white flight” as people moved out of the urban areas in search of decent schools.  I saw the march of Common Purpose Marxism through the education system, the police and the judicial system.  I saw  Muslims practice child grooming and pedophilia rape gangs.  I saw the police turn a blind eye. It took years  and immense public pressure before arrests and prosecutions were made.  That is waaycist you see.  And this was to the detriment of decent law-abiding and upright Muslims that were my friends and work colleagues.  Everyone suffers when justice is not done, when “fictive reality” becomes the norm.

Did anyone ask why the UK was flooded with refugees?   Why Europe was flooded with refugees?   That was done on purpose.   They money men and the deep state shattered the Middle East to create Greater Israel and the Bridge and Road.   They knew that refugees would flood into Europe and destroy centuries of culture.  The great replacement had begun.  In order to build the MacKinder world Island they need to make you feel guilty over your ancestry.  You need to bow the knee because you are white.  Yet their race based weapon (Covid19)  targets whites and blacks (Ashkenazi Jews or Chinese to  a lesser extent).    They only care about themselves.  They are the only ones fit to rule the world.  It was promised to them.

White terrorists

How many of these “nationalists” groups have been penetrated by (very dumb) “intelligence assets”.  It is a well worn tactic.  The FBI does it all the time. They even recruit mentally retarded people and give them bomb -making material.   Ahaa….we caught them in the act.  How many of the atrocities that we see are staged false flag incidents?  We will never know but I no longer trust stories like the Christ Church shooting   which led to gun-confiscation laws just before the “pandemic”.    So many of these incidents are “false flag” operations.  How about Port Arthur?   I honestly don’t know but it is all so suspicious.

Meet the terrorist

David Hiscox is a middle class piano teacher who is trying to fight the great replacement. This is not about “white supremacy” but the fact that people want to be left alone to work and live and enjoy their own community. A nation is based on family.

"You either have a a strong patriarchy, you know strong families strong dedication to God and a strong nation or you have a globalist empire (battle one) or you have just chaos..."

One of the NSN (National Socialist Network) members (Dave Ryan)  drove a car and trailer around Adelaide with racist slogans and NSN stickers upsetting people. Channel Nine filmed the guy and 60 minutes did a hit piece on nationalists, racists Nazis, Jew hating white supremacists. Can you see what is happening?

It sounds to me a bit like what they did with Brendon O’Connell although Brendon was never a member of any group. 

I am not promoting David Hiscox but I think it is important to know both sides of the story.  To this end I place two articles warning everyone against the evil neo-Nazis.  Every word in these articles is true (sic).   So, I place both sides of the story below and also a link to their website.  I am a great believer in censoring nothing….especially when so many lies are being told.  I think that people who can think critically and do research should make up their own mind. 

But remember this…..extremism begets extremism…and unrighteousness begets unrighteousness…and lies begets lies…and those who live by the sword will die by the sword.  In God’s view we are all sinners.  No one is superior. The Jews (who were elect) got taught a powerful lesson when God brought Gentiles into covenant relationship.  They never got over it.

 

 

Make up your own mind

 

The website =  https://xyz.net.au/

The David Hiscox Show Ep. 11: With Dr. Kevin McCairn

 

See what I write in this article:

Right Wing Extremism

Greatest balls up in psyop history

Greatest balls up in psyop history

Just a short video from Wake Up Australia. Great work exposing another psyop run by Avi Yemeni the Australian Jew (Zionist)  a Melbourne-based  social media personality and gym owner. As an adult Yemini moved to Israel, gained Israeli citizenship, and became a sharpshooter in the Israeli Defence Force (IDF) serving with the Golani Brigade from 2005 – 2008. Most of his active duty was spent in the Gaza Strip. Avi Yemini is the Australian Bureau Chief for Rebel News which is associated with Canadian (Jewish) lawyer  Ezra Levant, who in turn is associated with Tommy Robinson (not his real name) with his anti-immigration stance.  Now Tommy gained ground because of the Muslim child grooming and rape scandals in the UK and because of the unregulated mass immigration. Tommy is also a Ziomist and knows Avi.  Tommy has photographs of himself standing on an Israeli tank.

 

Who remembers this from last October?

The greatest balls up in Psyop history.

Avi Yemini once again instrumental.
Yet the sheep fell for it.

First video is from Peekay Truth

The 2nd video was from research from myself and Ana did last year.

A great video on this was by tell them they’re dreaming

Watch here (https://youtu.be/w3t6AhUpgZU)

Now do you understand?

You are in a bio-war and a psychological war.  Tommy Robinson in the UK made some very valid points. The police did turn a blind eye to criminal activity involving Muslims.  I know, because  I lived in Huddersfield for many years.  Eventually the gang was brought to justice because of mounting public pressure.  The police were captured by Common Purpose (cultural Marxism diversity etc) and dare not lift a finger.

The point is that the whole thing is a psyop. The Jews (the neo-conservatives in the USA) helped Israel destroy and balkanize the middle east.  The Muslim refugees fled to Europe looking for stability (who can blame them?).  Then the “far-right” reacts (Tommy Robinson). This is pure Hegelian Dialectic.   Problem, reaction solution. 

The problem was created by the Jews.  They want you to understand that nation states are a failure.  The family unit is a failure (to be replaced by the State and corporate guardianship).  Competing governments are a failure.  We can’t even stop climate change or a pandemic, or pollution or refugees (mass migration) or poverty….so…..

The Jews also have the Solution…..one world Government…run by…ta ,da….the Jew.  If only we had more Jews and bankers in charge (same thing) then everything would be OK. Look, I have nothing against a Jew running the world as long as it is Jesus Christ.  You know, the same Jew who turned around and said your father was a liar and a murder from the beginning.  Yeah, that one.

 

Antisemitic

Notification: Antisemitic canard

This notification is for new visitors.  I believe the Jewish people have been betrayed by their elite.  This is exactly what happened in the first century when aristocratic priests under a foreign Edomite client King (Herod) backed by religious zealots (Pharisees) in collaboration with Roman power sold out the “publicans and sinners” who heard Jesus gladly. They are Ruthless leaders as I made apparent in this article:

Ruthless leaders

 

They have betrayed the Jewish people as I make apparent here:

 

Christian-Zionists

Christian -Zionists are the enemy of truth.  They are deluded. God did not command the Jews to conquer the land; it was an imperialist Rothschild project. The descendants of Abraham are those who do the WORKS of Abraham (John 8:39) {Abraham’s work was the offering of Isaac…it was an ACT of messianic faith- in so doing he kept the “whole law” even before it was given Gen 26:5).}   Israel is the Great Harlot and the beast system is controlled by the Jewish elite. They have even betrayed their own people like they did in the first century. They are not “the Israel of God” and they are about to be punished. Deluded Christians need to wake up.

Israel is a Redshield project.  It would not surprise me if that family descended from Edom.

 

Bibi boasting how easy it is to manipulate the USA

Bibi and the Chabad Lubavitcher Rebbe

In November 1990. What are you doing to hasten the Messiah? (lol) I am doing…I am doing…

Whatcha doin Bibi?   Preparing for 9/11?  Fine tuning the Yinon plan?  Compromising politicians?  Back-door-ing chips and infra structure?  Transferring tech to Russia and China?  Whatcha doin?

 

Jew World Order

Jew World Order

Anti-Semitic?  No…..just the facts brought to you by a Jewish convert to Orthodox Christianity.  Facts are facts and Jews run the world and are behind the virus. All the Pharma companies are run by Jews. Facebbook, YouTube and Google are Jewish.  The banks are Jewish. The Federal Reserve was established by Jews. Charles Schwab (WEF) is Jewish and so on.

The Biden Government is Jewish:

  1. Janet Yellin( ✡️) Secretary Treasury
  2. Merrick Garland( ✡️) Attorney General
  3. Alejandro Mayorkas( ✡️) Secretary Homeland Security
  4. Avril Haines( ✡️) Director National Intelligence
  5. Anthony Blinken( ✡️) Secretary of State
  6. Wendy Sherman( ✡️) Deputy Secretary of State
  7. Victoria Nuland( ✡️) Secretary State Political Affairs
  8. Eric Lander( ✡️) Office of Science Technology
  9. Robert Klain( ✡️) Chief of Staff
  10. David Cohen( ✡️) Director CIA
  11. Jeffry Zeints ✡️() Covid Czar
  12. Rachel Levine( ✡️) Asst Health Secretary
  13. Rochelle Wolensky ( ✡️) Director of the CDC
  14. Anne Neuberger ( ✡️) (2021–present) for Cyber and Emerging Technology.
  15. Andy Slavitt ( ✡️) Center for Medicare and Medicaid Services
  16. Isabel Guzman ( ✡️) Administrator of the Small Business Administration JERUSALEM POST All the Jews Joe Biden has tapped for top roles in his administration

 

However, don’t you dare say anything you white supremacist, antisemitic, racist goy. The Jews do not identify as “white” but as oppressed “people of color”.  Perhaps the US Government needs to practice affirmative action so that white people can get government jobs (lol). Have you figured out yet who the Beast is or are you a little bit slow?

 

Biden’s Slew Of Jews by Brother Nathanael

 

Ruthless leaders

Ruthless Leaders

The etymology of the word Ruthless is interesting – apparently the English word Ruth comes from archaic Germanic.  Ruth means merciful or kind…having pity.  Here is a very short article and 4 minute podcast on the meaning of Ruth. However, I came across an answer that I thought more fitting – it comes from the biblical story of Ruth who showed such kindness and pity to her Jewish mother in Law.  Therefore, the characteristic of ruthlessness is one that is the opposite and shows no pity or mercy. Businessmen are often described as “ruthless” as are bankers, generals and psychopaths.  It is not a good quality and nothing to be proud of.

The Jewish people have been let down by ruthless leaders for the last two millennia. They do not care who they sacrifice on the altar of their ambition. They will and have used anything (including the Holocaust) to achieve their ends.  Manipulation, deceit, shaming, lying and utter ruthlessness.   The deagle website predicted that the Israeli population would be reduced by 50% by 2025.  We urge the Jewish people to distance themselves from their corrupt leadership. The Apocalypse calls to the people of God to “come out of her” (the Great Babylon) and we hope that the Jewish people heed the message.  Moses Eleftheria (=Greek for Freedom) says – “Let my people Go”

 

 

 

Antisemitism

The antisemitic canard is  being employed to block all criticism.   It is like a terrorist using women and children as a human shield.  Only the weak minded and propagandized fall for the trick.  The ruthless Jewish leadership are the most powerful cabal in the world. They control the media, pharma and banking industries….in fact they control the USA and a number of institutions.  They are not victims.  If they are being criticized it is because of their behavior.

 

Jew World Order

Jew World Order

I  was sent a video link which led to an interesting and informative channel which I have yet to fully explore.  The video posted below was recommended as giving the best overview but there are a number of other interesting topics to examine…..if the channel remains up and is not censored.  

When I started investigating the name of the video producer rang a bell but it did not fully click….then all of a sudden it started to dawn on me.  He was the guy who was jailed for two years because he was a “racist”  and an “antisemitic”.  He has now served his sentence and has fled Australia and is claiming asylum. 

He has produced an interesting PDF document detailing his claim for asylum and explaining the injustice done to him.  His name is Brendan Lee O’Connell and it all started with a pro-Palestinian (anti-Zionist) protest at an IGA supermarket about Jaffa Oranges. He was engaged by two young  guys in a conversation outside who turned out to be left-wing Jewish students. The encounter was posted on FaceBook and apparently other Jews  piled in one of them making violent threats to a Muslim protester in front of his wife and children. What I gather from this is that it was grossly exaggerated and he faced a Kangaroo court. Jewish influence reaches far and wide. While in jail his sister died under suspicious circumstances and he was beaten and his arm broken.   This is obviously not how you win friends and influence people and it has left him even more determined to expose what is being done.

Speaking from experience if you engage on twitter and are even the slightest bit critical you face a barrage of ad hominem attacks. You end up having a dozen  people calling you names and the response is stereotypical projection and name calling,  hypocrisy and dishonesty. They are at one and the same time hostile and yet they play the victim. It is impossible to have a reasoned conversation. There is no introspection or reflection. Of course what I have said is a generalization and not true for everybody but a certain group mentality takes hold that reflects narcissism and sociopathy. 

On August the 10th, 2010a major international incident occurred that was shocking in it's implications. A foreign nation directly interfered in a sovereign nations legal process. This has never happened before. One man - Brendon Lee O'Connell - was taking on the Israeli state and it's treatment of the indigenous Palestinian people. This had given rise to O'Connell being charged under the states draconian racial vilification legislation whereby he had called a hard core Zionist activist a "racist Jew" at a public political rally. He filmed the entire confrontation. O'Connell gladly went to trial and stated openly he would raise issues of national security and Jewish racial and religious supremacism as the foundation of the Israeli state, as issues, at trial. All of a sudden, the entire Israeli state came out against him including the Israeli Ambassador, Israeli Deputy Foreign Minister and Australian foreign minister.

His Document is over a thousand pages but I recommend reading page 868 Appendix 9-My precise attitude to Jewish Issues (very good with documented evidence). Download here: htts://mega.nz/file/x6hDWYaR#GOaK-TCZBF_acroFHgYa6bi3r1TZ-O8btzYYG7b6XkI

Quotes from his document:

In short, a simple altercation at a Friends of Palestine rally on May 2nd, 2009, turned into an international incident that continues to unfold, ten years on, which included three years in jail for “offending” the Perth Jewish community at a political rally in support of the Palestinian people. [Page 8]

In an unprecedented international incident, the Israeli state came out against me in the lead up to my trial by organising a “Friends of Israel” rally a week before the trial. No FOI rally had been held in my home state before.[Page 9]

I was placed in maximum security settings though classified a minimum-security prisoner. I was badly beaten unconscious and suffered a badly broken arm left untreated for a month. This was literal torture. It is all [Page9]

Top lawyers paid to facilitate my High Court appeal expressed over and over, on camera, how much they feared the Israeli state and their own personal safety. This is all recorded and contained within the document. [Page10]

FaceBook posts screenshots can be found on page 562 of his document.

The offending video can be found about half way down on this website. Brendon O’Connell confronts Zionist death cult member and president of Australian Association of Jewish Students, after they were caught gathering intelligence on Pro-Palestine demonstrations:

‘Brendon O’Connell’

 His YouTube Channel

Why they are allowing him a YouTube channel is beyond me. Possibly because it is easy to monitor him and collect data on visitor numbers?  He has some good videos by the looks of it – I place here the one he recommends to start with.   One thing I have noted is that he is very hard against Alex Jones and Info Wars….and rightly so because he is a Zionist sell out.  He also seems disappointed with Adam Green something to do with white nationalism??   I will have to dig into that.   He said some interesting things about Steve Bannon, who was arrested in August on a luxury yacht and is alleged to have siphoned money from an online fundraiser for Trump’s border wall but this happened after Bannon openly criticized Kissinger.  Stephen Kevin Bannon is an American media executive, political strategist, former investment banker, and the former executive chairman of Breitbart News. He served as the White House’s chief strategist in the administration of U.S. President Donald Trump during the first seven months of Trump’s term. I will have to find and post that video.  Anyway…recommended watching:

5. TRUMP v CORONA | 2020 & THE FORCED ECONOMIC COLLAPSE OF AMERICA

Show Notes

(These are Brendan’s notes): VIDEO ON BIT CHUTE: *Israeli tech will help reshape world after pandemic* https://www.israel21c.org/israeli-tec… *Trump says 5 to 6 Arab countries will sign deals, gives Netanyahu key to White House* https://worldisraelnews.com/trump-say… Its amazing. The crisis happens, and there is Israel ready to assist you with billions in technology they “invented”, just for this occasion. Just lucky I guess. UN Refugee Application | Brendon Lee O’Connell – 100MB PDF file https://mega.nz/#!x6hDWYaR!GOaK-TCZBF… https://archive.org/details/7finalunh… BRIEFING DOCUMENT | ISRAELI HIGH TECH & ESPIONAGE Ironically typed up 300m from the Beirut blast site at RAMZI AIRB&B https://mega.nz/file/wu41ADDA#2mRvtNs… SUFYAN’S ARABIC TRANSLATION CHANNEL Please support our efforts to bring Muslims, Christians and Jews together. https://www.youtube.com/channel/UCJyI… https://www.patreon.com/talpiot BTC – bc1qjjk3fpgymx98hd739vvsvt5ngeqwdj6jzthw8h BCH – qqhnn9pts9hdrzm2n8vvf5mvnee7nw2gw5neugv89n ETH – 0x076C06ba1fAbe73bcD5105027C1C7AA8a0F44dF7 LTC – LKhLQECrB5Kf6gPWcAxhxyb6Pu2ih18KaQ Acc Name: Brendon L. OConnell Bank: St George Bank, Perth, Central Business District Acc No: 055164731 BSB: 116879 SWIFF Code: SGBLAU2S *Intel CEO: We think of ourselves as an Israeli company as much as a US company* https://m.jpost.com/Israel-News/Intel… *Intel launches new processors that bring AI to the PC, sired by Haifa team* https://www.timesofisrael.com/intel-l… *FBI source in Russia probe called Israelis ‘f***ing spies’ who should be killed* DOJ releases transcript of source speaking with George Papadopoulos, who was probed by Mueller over his ties to Israel, which includes references to the Mossad, ‘fake’ Russian Jews https://www.timesofisrael.com/fbi-sou… *Microsoft’s Bill Gates: Israel is a vital resource for us* https://www.israel21c.org/microsofts-… *10 great reasons why Microsoft loves Israeli ingenuity* Microsoft Israel has long been credited for contributing significantly to the development of major parts of the Windows software as well as its IT security and telecommunications technologies. … Development of the Microsoft Security Essentials anti-virus suite began in December 2008 at the R&D center in Herzliya. … Numerous reports suggest that the multinational company is transforming its Israeli R&D centers into the nucleus for global development of cyber-tech for Windows and Microsoft cloud services. https://www.israel21c.org/10-great-re… *What The World’s Top 10 Tech Firms Have In Common* The world’s top ten tech companies –Microsoft, Apple, Amazon, Google, Facebook, Alibaba, Intel, Oracle, Samsung and Baidu–increasingly have something in common: they’re dBig video coming soon tying seemingly disparate characters, events and grand strategic plans, bent on shattering the United States and it’s Constitution into a thousand pieces. Sorry, professional Mic ran out of batteries. 5. TRUMP v CORONA | 2020 & THE FORCED ECONOMIC COLLAPSE OF AMERICA https://www.youtube.com/watch?v=utezZ… 11. ALEX JONES ADMITS TRUMP A PRODUCT OF U.S ARMY INTELLIGENCE https://www.youtube.com/watch?v=VIWF1… 17. COVID-19 KILL SWITCH | DID ISRAEL INVENT 5G & WHY ARE THEY SO SLOW TO BUILD 5G NETWORKS? https://www.youtube.com/watch?v=QD_hU… 6. COVID KILL SWITCH | ISRAEL & MICROSOFT, HOW THEY SUBVERT AMERICA https://www.youtube.com/watch?v=OWfDq… 7. COVID KILL SWITCH | ISRAEL & UNIT 8200 TAKE OVER NEW YORK & PENTAGON https://www.youtube.com/watch?v=8RQF1… 8. COVID KILL SWITCH | A FEW GOOD JEWS – DEM PRESIDENTIAL HOPEFULS AMBUSHED ON THE STREETS…ISRAEL https://www.youtube.com/watch?v=5JUIC… 9. COVID KILL SWITCH | ISRAELS SECRET WEAPON, THE TALPIOT PROGRAM – REMASTERED https://www.youtube.com/watch?v=qZ9_U… 1. COVID 19, WAR WITH CHINA, ISRAEL, 911 & THE BOEING UN-INTERUPTABLE AUTOPILOT | RE-EDIT https://www.youtube.com/watch?v=CCcGz… 10. COVID 19 KILL SWITCH | ISRAELI DRONES WORLD WIDE, HOW ISRAEL RUSSIA, IRAN & CHINA WORK TOGETHER https://www.youtube.com/watch?v=XFHU6… https://www.patreon.com/talpiot BTC – bc1qjjk3fpgymx98hd739vvsvt5ngeqwdj6jzthw8h BCH – qqhnn9pts9hdrzm2n8vvf5mvnee7nw2gw5neugv89n ETH – 0x076C06ba1fAbe73bcD5105027C1C7AA8a0F44dF7 LTC – LKhLQECrB5Kf6gPWcAxhxyb6Pu2ih18KaQ Acc Name: Brendon L. OConnell Bank: St George Bank, Perth, Central Business District Acc No: 055164731 BSB: 116879 SWIFF Code: SGBLAU2S UN Refugee Application | Brendon Lee O’Connell – 100MB PDF file https://mega.nz/#!x6hDWYaR!GOaK-TCZBF… https://archive.org/details/7finalunh… BRIEFING DOCUMENT | ISRAELI HIGH TECH & ESPIONAGE Ironically typed up 300m from the Beirut blast site at RAMZI AIRB&B https://mega.nz/file/wu41ADDA#2mRvtNs… SUFYAN’S ARABIC TRANSLATION CHANNEL Please support our efforts to bring Muslims, Christians and Jews together. https://www.youtube.com/channel/UCJyI… *Trump, Fox News – “Putin loves Israel and Bi Bi”* https://www.youtube.com/watch?v=bQYos… *FBI source in Russia probe called Israelis ‘f***ing spies’ who should be killed* DOJ releases transcript of source speaking with George Papadopoulos, who was probed by Mueller over his ties to Israel, which includes references to the Mossad, ‘fake’ Russian Jews https://www.timesofisrael.com/fbi-sou… *Borscht Belt: Will Israel Spurn America for Russia?* https://observer.com/2015/01/borscht-… *Israel to lure Soviet Jews from Germany* https://www.theguardian.com/world/200… *Israel’s former Soviet immigrants transform adopted country* https://www.theguardian.com/world/201… *Why Russia Needs Israel* https://besacenter.org/perspectives-p… *Why Russia should take over Israel’s defense from America* http://theweek.com/articles/562830/wh… *Israel and Iran both set to join Russia-led free trade zone* After two rounds of negotiations, Jerusalem close to agreement with Eurasian Economic Union; separately, Tehran also set to sign deal ‘in the near future’ https://www.timesofisrael.com/israel-… *As Putin Becomes One of World’s Most Powerful Players, His Surprising Jewish Connection is Revealed* https://www.breakingisraelnews.com/55… *An Emerging Alliance: Russia and Israel* https://spectator.org/an-emerging-all… *Shin Bet Withheld Iran Secrets from Lieberman [Sec.Def Israel] as Security Risk* https://www.richardsilverstein.com/20… *KGB Infiltrated Highest Echelons of Israel’s Army, Business, and Political Leadership* https://www.richardsilverstein.com/20… *Like Putting the K.G.B. Into the Pentagon* https://www.nytimes.com/1987/06/30/op… *’The USSR Is Our Second Homeland,’ Said One Kibbutznik When Stalin Died* https://www.haaretz.com/.premium-nost… *The KGB’s Middle East Files: ‘Illegals’ in Israel – Russian agents and assets in Israel and elsewhere* https://www.ynetnews.com/articles/0,7…oing mission-critical work in Israel that’s core to their businesses back at HQ. … To be sure, Israel is a complicated place, but it is also undoubtedly becoming the world’s innovation accelerator, a global beta site and test hub for new ideas in everything from life sciences to autonomous vehicles. https://www.forbes.com/sites/startupn… *From Jerusalem shall come forth cyber-security, says cyber guru* https://www.timesofisrael.com/from-je… *In Surprise Move, Microsoft Israel’s R&D Center Names New 34-year-old CEO* https://www.haaretz.com/israel-news/b… *As hackers gain strength, Israeli cyber firms raise more money than ever* https://www.jpost.com/Jpost-Tech/As-h… *Israel’s former Soviet immigrants transform adopted country* https://www.theguardian.com/world/201… *Why Russia should take over Israel’s defense from America* http://theweek.com/articles/562830/wh… *Israel and Iran both set to join Russia-led free trade zone* https://www.timesofisrael.com/israel-…

Recommended Viewing Order

Under a different video he has the following nine viewing recommendations (he has 65 videos in total) and links to other online resources.

  1. TRUMP v CORONA | 2020 & THE FORCED ECONOMIC COLLAPSE OF AMERICA https://www.youtube.com/watch?v=utezZ… 11. ALEX JONES ADMITS TRUMP A PRODUCT OF U.S ARMY INTELLIGENCE https://www.youtube.com/watch?v=VIWF1… 17. COVID-19 KILL SWITCH | DID ISRAEL INVENT 5G & WHY ARE THEY SO SLOW TO BUILD 5G NETWORKS? https://www.youtube.com/watch?v=QD_hU… 6. COVID KILL SWITCH | ISRAEL & MICROSOFT, HOW THEY SUBVERT AMERICA https://www.youtube.com/watch?v=OWfDq… 7. COVID KILL SWITCH | ISRAEL & UNIT 8200 TAKE OVER NEW YORK & PENTAGON https://www.youtube.com/watch?v=8RQF1… 8. COVID KILL SWITCH | A FEW GOOD JEWS – DEM PRESIDENTIAL HOPEFULS AMBUSHED ON THE STREETS…ISRAEL https://www.youtube.com/watch?v=5JUIC… 9. COVID KILL SWITCH | ISRAELS SECRET WEAPON, THE TALPIOT PROGRAM – REMASTERED https://www.youtube.com/watch?v=qZ9_U… 1. COVID 19, WAR WITH CHINA, ISRAEL, 911 & THE BOEING UN-INTERUPTABLE AUTOPILOT | RE-EDIT https://www.youtube.com/watch?v=CCcGz… 10. COVID 19 KILL SWITCH | ISRAELI DRONES WORLD WIDE, HOW ISRAEL RUSSIA, IRAN & CHINA WORK TOGETHER https://www.youtube.com/watch?v=XFHU6… https://www.patreon.com/talpiot BTC – bc1qjjk3fpgymx98hd739vvsvt5ngeqwdj6jzthw8h BCH – qqhnn9pts9hdrzm2n8vvf5mvnee7nw2gw5neugv89n ETH – 0x076C06ba1fAbe73bcD5105027C1C7AA8a0F44dF7 LTC – LKhLQECrB5Kf6gPWcAxhxyb6Pu2ih18KaQ Acc Name: Brendon L. OConnell Bank: St George Bank, Perth, Central Business District Acc No: 055164731 BSB: 116879 SWIFF Code: SGBLAU2S UN Refugee Application | Brendon Lee O’Connell – 100MB PDF file https://mega.nz/#!x6hDWYaR!GOaK-TCZBF… https://archive.org/details/7finalunh… BRIEFING DOCUMENT | ISRAELI HIGH TECH & ESPIONAGE Ironically typed up 300m from the Beirut blast site at RAMZI AIRB&B https://mega.nz/file/wu41ADDA#2mRvtNs… SUFYAN’S ARABIC TRANSLATION CHANNEL Please support our efforts to bring Muslims, Christians and Jews together. https://www.youtube.com/channel/UCJyI… *Trump, Fox News – “Putin loves Israel and Bi Bi”* https://www.youtube.com/watch?v=bQYos… *FBI source in Russia probe called Israelis ‘f***ing spies’ who should be killed* DOJ releases transcript of source speaking with George Papadopoulos, who was probed by Mueller over his ties to Israel, which includes references to the Mossad, ‘fake’ Russian Jews https://www.timesofisrael.com/fbi-sou… *Borscht Belt: Will Israel Spurn America for Russia?* https://observer.com/2015/01/borscht-… *Israel to lure Soviet Jews from Germany* https://www.theguardian.com/world/200… *Israel’s former Soviet immigrants transform adopted country* https://www.theguardian.com/world/201… *Why Russia Needs Israel* https://besacenter.org/perspectives-p… *Why Russia should take over Israel’s defense from America* http://theweek.com/articles/562830/wh… *Israel and Iran both set to join Russia-led free trade zone* After two rounds of negotiations, Jerusalem close to agreement with Eurasian Economic Union; separately, Tehran also set to sign deal ‘in the near future’ https://www.timesofisrael.com/israel-… *As Putin Becomes One of World’s Most Powerful Players, His Surprising Jewish Connection is Revealed* https://www.breakingisraelnews.com/55… *An Emerging Alliance: Russia and Israel* https://spectator.org/an-emerging-all… *Shin Bet Withheld Iran Secrets from Lieberman [Sec.Def Israel] as Security Risk* https://www.richardsilverstein.com/20… *KGB Infiltrated Highest Echelons of Israel’s Army, Business, and Political Leadership* https://www.richardsilverstein.com/20… *Like Putting the K.G.B. Into the Pentagon* https://www.nytimes.com/1987/06/30/op… *’The USSR Is Our Second Homeland,’ Said One Kibbutznik When Stalin Died* https://www.haaretz.com/.premium-nost… *The KGB’s Middle East Files: ‘Illegals’ in Israel – Russian agents and assets in Israel and elsewhere* https://www.ynetnews.com/articles/0,7…

Conclusion

Most definitely a site that is a good resource and worthy of support.  He is coming to much the same conclusion as I have.  The world is run by corporations and military intelligence in corporation with gangsters. Politicians are just puppets. There is a  global, evil criminal enterprise involved in war, drugs and the sex trade and banking.  The Jews are at the very heart of the corrupt cabal.  They have decided that now is the time to herd us into slave cities and reduce our numbers.

 

 

 

 

American politics

American politics

American politics, the “Jewish question” and the Pandemic are all tied in with the upcoming election.  There are many Christians on the right of the spectrum (many Qanon supporters) that see Trump as a savior.   That is understandable in some ways as a backlash against the Marxism, racism and other crazy stuff introduced by the left.  But they are being played using the Hegelian dialect.  The Biden and Harris team is hardly credible.  Anyway, Adam does not fall for the ploy. The only objection I had was some of the remarks he made about the OT so I left this comment:

Adam, great show....but you are starting to hold the same ideas on the Torah and Yahweh as Christopher Jon Bjerknes. The Torah is not the Talmud or the Zohar/Kabbalah. Unfortunately Christopher Jon Bjerknes has fallen prey to the mistake that many Christians make, which is rejection of the Old Testament God. I understand how this has happened and in some ways it is a natural reaction (over reaction). However, the jealous God of the OT is the same loving Father of the NT not a different being. The revulsion comes from the spin that traditional Judaism has put on the Torah. The jealousy of God should be understood within the covenant relationship (marriage to Israel) who were made to drink the waters of jealousy for their infidelity (Ex 32:20 compare Num 5: 24). It is not to be understood as genocidal impulses (Bjerknes) just as the war against Amelek from generation to generation is a metaphor for the war against sin which was typified by Moses stretching his arms out in the symbol of the cross (Ex 17:10-16). I place Bjerknes video on my website because he has an extensive knowledge of the Kabbalah , Zohar etc…not because of his knowledge of the Torah. See=https://www.biblaridion.info/blog/the-depths-of-satan/

Adam talks about the Mark of the Beast at the following timestamp=https://youtu.be/jWFtEYGFaaw?t=880

Although Tucker Carlson is considered “right-wing” (Trump supporter) nevertheless his remarks regarding getting back to normal are valid:

 

China & Russia

China & Russia

How do China & Russia fit in with what is happening?  I thought I would post some videos on the subject that show somewhat contrasting views to get you thinking on the subject.  I will also give my own opinion on the subject and ask questions. 

What do Russia and China have in common?

Both Russia and China are no longer “communist” (especially Russia) but the Communist or Bolshevik movement in Russia was Jewish….however, not many realize that the Communist revolution in China was also Jewish.  I post a link here to a very good thread on the subject which I suggest you have a look through at your leisure.  It is a real eye opener and I have backed it up because all sorts of things are disappearing of the internet nowadays.

China Thread

This is very…..very good…..

http://archive.is/nRODk

 

Brother Nathaniel on Russia

Brother Nathaniel is a Jew who converted to Orthodox Christianity.   So, he is a big fan of what Putin is doing in Russia.  Putin has brought back the Church to the center of Russian life and Russian values. He has also revalued the importance of the family unit and clamped down on homosexuality etc.   I watched the first half of the first video and it was very good (but long) the videos are placed here as much for my own benefit as anything else, will go back and watch them fully when I have more time.

From what I have already seen bro Nathaniel regards Putin as a good guy. Putin is certainly a statesman and has strategic smarts.  I don’t believe anybody is a good guy but he is certainly turning the fortunes of Russia around.  However, there are many others who regard Putin as a Zionist.   Now this is a complex question because Russia and the Jews have a history together.  Putin himself was close to a Jewish couple who used to look after him when he would come home from school.  Most of the oligarchs in Russia are Jewish. Putin has good relations with the Rabbi’s and with Israel. Nearly a million Russian Jews live in Israel. Moreover, Putin seems to have a good relation with Trump who is a Zionist.  I think Putin is happier dealing with Zionist (nationalist) Jews than with internationalist (globalist) Jews. He certainly does not want any “dual citizens” with split loyalties holding any Government positions.  This disadvantages both the Globalist Jews and the Zionist Jews. So, I think Putin is just being pragmatic although he does favor the nationalists.  These next two videos are very informative and very pro-Putin.  Afterwards I will post one that shows a darker side.

Brother Nathanael pack on Russia / Putin (& the jews) 2010 to 2015 (1 of 2)

Brother Nathanael pack on Russia / Putin (& the jews) 2015 to end of 2019 (2 of 2)

 We would argue that Putin’s approach is pragmatic while others see him as a Zionist stooge and those who support him as controlled opposition or Russia apologists.

Russia and Gog

Controlled opposition?

The next video states that  people like Richard Spencer, David Duke, brother Nathanael, Mike Enoch, Heimbach who promote Putin are controlled opposition.The aforementioned people are anti-Zionist and often regarded as anti-Semitic.  It is argued that in Russia you land in jail for being a nationalist, or for denying the holocaust or for being anti-Semitic.  This video is basically saying that Putin is not “the great white hope” that he is portrayed to be but that he is in league with the Zionists.

There is some truth in all of the above but Russia acts out of Russian interests. Perhaps you do end up in jail if you are a “nationalist”…..but what kind of nationalist…..a “separatist” who wants to fragment the Russian federation?  Perhaps you end up in jail if you deny the holocaust…..but Russia has many powerful Jewish interests and it would be foolish to unnecessarily antagonize them.   He has encouraged a resurgence of Christianity but he is also tolerant towards Judaism.  In my view that is just pragmatism.  He seems intent on making Russia as independent as possible from any globalist NWO.  Anyway, I post this video to give a balanced view of the many undercurrents:

Beware of the Dugin infiltrators

 

A communist (Jewish) world takeover

This video is even more extreme seeing the fall of Russia and East Germany (when the wall came down) as a stage managed event.  Bjerknes says the following; “The fall of Communism in Red China appears to be stage managed just like the phony dissolution of the Soviet Union, which is today led by KGB chieftain Vladimir Putin. Donald Trump is acting as the new Trotskyite neo-Con mirroring Ronald Reagan’s act. China is the new “evil empire” and Soviet Russia the new ally of the false Right”.

The Fake Fall of Red China

China Taking Over

 Conclusions

If you watched all the above videos and are confused that is a good thing.  You should be confused. There is a great game being played and a lot of disinformation out there. I believe that Books is wrong when he says that Putin and Bolsonaro are killing there own people using Covid-19.  That is clearly leftist (globalist) propaganda. The figures coming out of Russia and Brazil are massaged and inflated. The globalists want the economy of Brazil and Russia destroyed and Putin and  Bolsonaro are refusing to comply. The bit about the fires in Brazil is also propaganda as it was not worse than other years. Bolsonaro is a Zionist and a Trump ally and Putin is also friendly with Trump and a (marginal) Zionist.  So these two leaders are fighting against the more extreme version of globalism and choosing either the Zionist version or a more independent multi-polarity over one world rule. Otherwise why would Russia strive to decouple the internet from the global system?  I believe Putin is being pragmatic with the Zionists but drawing a line in the sand regarding Syria.  He has done naval exercises with Iran and China as a threat to the Zionists – thus far and no further. Does he want to increase Russian influence in Europe?  Of course, he sees them as a natural ally.  Does he want globalism aka Chinese style Sino-commie-capitalism?  I think he will cooperate with the bridge and road but not allow the unique character of mother Russia to be overwhelmed by  globalist -Jewish-control.

A great game is being played for world hegemony. Whoever wins, the Jews win, whether that is via the Chinese (globalist Jews) or via the Anglo-Zionists.    If the globalists win you can expect a communist style repression of religion. If the Anglo-Zionist win there will probably be more religious freedom (maybe) but only if the “Noahide Laws” are obeyed and only if Christianity becomes a secondary offshoot to Judaism with Jesus demoted to the status of a prophet.

 

Update

Interesting to note that Christianity is only allowed in Russia if it is in state approved Churches.  So, not real freedom of religion.