Free the Jews (52 min)
Highly Recommended
This is very good and exactly what I have always said. The Jewish people are being used by their own power “elite”. They have been deliberately victimized and traumatized. They use it as a tool.
Highly Recommended
This is very good and exactly what I have always said. The Jewish people are being used by their own power “elite”. They have been deliberately victimized and traumatized. They use it as a tool.
Here is the last part in the series.
RED (Part 4): Money is a Gas (2:16)
The others parts can be traced back here:
Many of the video clips are from from Unpacked
Blog of Dr. Dannielle Blumenthal
https://americans4innovation.blogspot.com/2022/09/the-rothschilds-via-reuters-control.html
https://en.wikipedia.org/wiki/Frankfurt_School
https://en.wikipedia.org/wiki/List_of_people_from_Frankfurt
https://www.academia.edu/3815476/THE_USURY_CIVILIZATION_The_new_world_order_of_interest_capitalism
https://www.rothschildarchive.org/exhibitions/timeline/
This is a 20 min video which I suspect has been clipped from a full show and uploaded to WTYL. Jonathan is right to be angry. These people are monsters and liars. We have encountered Hotez before. If you dare question anything you are anti-science.
— The Tishbite (@Tishbite_redux) July 23, 2022
Dr Peter Hotez is a pediatrician who can’t wait to get his hands on your kids and inject them. His own daughter is retarded. Has that got anything to do with the horrendous childhood vaccination schedule in the US? Is it normal to vaccinate babies against sexual diseases? Is there something they are not telling us?
Peter Hotez is one of a coterie who are all Ashkenazi and who are connected to Georgetown University a Catholic and Jesuit private research institution in Washington, D.C. We all know the connection between Jesuits and Jews. Amongst the alumni are such shining lights as Bill Clinton and John Podesta. Georgetown University seems to be a finishing school for Deep State actors. Avril Haines (an Ashkenazi Chabad Jew) the current Director of National Intelligence and attendee of Event 201 (with George Gao head of the Chinese CDC).
Moreover, Dr. Hotez was the doctoral thesis advisor for Dr. Rebecca Katz at Georgetown University another Ashkenazi Jew whose parents link back to Fauci and who said this in June of 2019 (2 min clip):
It is Good Friday the start of the Christian holiday known to most people as Easter. Of course, Easter itself is based on the Jewish Passover and is the feast associated by Christians with the death and resurrection of Jesus. It is interesting that Victoria police should use Easter to put out a PR message to placate a public that they have brutalized during the lockdowns. Even though their message is deliberately anti-Christian and pagan they inadvertently do us a favor by highlighting important issues.
While these bunnies may look cute and cuddly, don’t be fooled. Police allege there is video evidence of Lucifer and Azrael on a crime spree through Melbourne this week. pic.twitter.com/6Wwnd83QYT
— Victoria Police (@VictoriaPolice) April 13, 2022
We have two “bunnies” and the mention of Lucifer and Azazel in this tweet. Many Jews would equate Azazel (Lev 16:8) with Lucifer and the choice of two bunnies is a deliberate play on choosing two goats for the Day of Atonement feast. One goat (known as the scapegoat) was released and sent to Azazel (sent to the devil) and the other goat was sacrificed. I have written extensively on the scapegoat phenomenon but essentially the goat that is sent away into exile is the nation of Israel and the goat that was sacrificed is Christ. The Gospels relate the passion scene as a combination of both feasts (Passover and Atonement) with Jesus (the son of the Father) sacrificed (Goat for Yahweh) and the other son of the father (Barabbas the goat for Azazel) released.
The Passion of the Christ (2004) – Free Barabbas (3 min)
Indeed, it is speculated by some that Barabbas might have been one of those who abandoned discipleship (John 6:66) because Jesus refused to be crowned King (John 6:15) and to lead a violent revolt against the Romans. If that is the case, then Barabbas as an ex-disciple would have been tried for insurrection and murder (Mark 15:7) not just for robbery.
John 6, the chapter in which many disciples abandon the Christ is the famous “hard saying” (John 6:60) which is about “eating him” (John 6:57). This deliberately proactive saying was an abomination to the Jews with their kosher food laws and is also misunderstood as the doctrine of transubstantiation by some Christians.
It is something more “modern” that has been taken up by “identity politics”. In the present clown world of cultural Marxism, you can choose to identify as male/female or whatever you may wish. In Contrast by the act of the eucharist and eating bread and drinking wine Christians are making a statement that they identify with Christ (John 6:54-56). In other words, the Christian is demonstrating that his flesh and blood has become joined to the flesh and blood of Christ. Our humanity becomes like his humanity which is dead to ego expressed as sin. This does not mean that we are sinless but that we (like Abraham) are counted as righteous because of faith. The two ritual instructions given to us by Christ (baptism and the eucharist) are both concerned with identifying with him. Jesus becomes the fulfilment of the two critical Jewish feasts. He is both the goat slain for Yahweh on the Day of Atonement and the Lamb of God (John 1:29) killed on Passover and celebrating the deliverance out of the land of death (Egypt with its Pyramid tombs).
Many Christians point out that the Christian celebration of the Lord’s Passover has been paganised with “chocolate eggs” etc which are ancient symbols of fertility rites. They are of course correct because there is an element of syncretism just as there is with the celebration of Christmas.
Easter is the pagan festival of spring, the years rebirth of resurrection. The name comes from the Saxon Goddess of spring, Oestre, who also gives her name to the estrus-cycle. Her name is cognate with Ostarte, Astarte, Ishtar, Ashtoreth. #TheTruthAboutEaster pic.twitter.com/lTQMjuvV2h
— Goddess Serena – 𝒢𝓎𝓃𝒶𝓇𝒸𝒽𝓎 𝒢𝑜𝒹𝒹𝑒𝓈𝓈 (@gynarchygoddess) April 4, 2021
On these matters I take the advice of the apostle Paul (Rom 14:5-6) and although I do enjoy my chocolate eggs and easter buns I believe it is incumbent that Christians understand the importance of feast and if they are not running around naked worshiping a fertility goddess no harm no foul. It is however very interesting to understand the origins of Easter or Astarte in ancient Canaanite religion and how this relates to ancient Israel. Serious biblical scholars have known for some time that the Canaanite Baal had a consort (wife) called Astarte. We should not be surprised that this carried over to ancient Israelite religion where Yahweh was worshipped with a consort and that this was condemned by the prophets. Abraham was a former inhabitant of Ur where polytheistic religion was practiced when he received his revelation and was told to leave. The point is that the Old Testament depicts God as having a consort, but that consort (wife) becomes the people of faith (in the first place Israel) which was made to drink the waters of jealousy (Ex 32:20, Num 5:22) and given a bill of divorce for her whoredoms (cf. Hos 1:2). I recommend watching this video by William Dever who mentions Margret (I believe that is a reference to Margert Barker who I have corresponded with) and at about 54 minutes Leen Ritmijer (Who some of you may know). In any case the setting up of cult centres at Dan and Beersheba should be familiar to any Bible student as that was instigated by Jeraboam (1 Kings 12:27-33). Moreover, the centralization of the cult was undertaken by the reformers Hezekiah (2 Kings 18:4-5) and Josiah (2 Kings 23:5-25).
In the NT God is depicted as male and addressed by Jesus as a Father. Of course, we are dealing with anthropomorphic symbology because God is depicted as both male and female, but at the same time he is neither male nor female. God does not need to reproduce because he is eternal, and we are his offspring (Acts 17:28) made in his image (Gen 1:26). The El Shaddai epithet used in the OT denotes the female aspect of divine nature, namely “breasts”, denoting fertility and blessing epitomised in the promise to Eve (whose name means mother of the living Gen 3:20) that through pain and suffering the messianic ideal would be birthed. The point is that Yahweh is calling out a consort (wife) as a bride for his son with the Baptist depicted as the bridegroom (John 3:29) and the church as a bride (John 21:2) being invited to a wedding feast (the messianic banquet Matt 22:8-14, it is wedding garments/done Luke 14:22, garments (Rev 16:15-17) the banquet is Armageddon the Super of the Great God (Rev 19:17)) where the water for purifying the Jews (John 2:6) is transformed into the wine (blood) of the covenant. So, the ancient, corrupted symbols are being repurposed and demythologised to reflect their original intent.
Transhumanist (Jews) are trying to deify themselves and undo the blessing of fertility by becoming androgynous. Shekhinah, the ‘cloud of Yahweh’ in the Bible, a synonym for God’s presence in the rabbinic tradition, and a feminine hypostasis in the Kabbalah, is a popular theological image in contemporary Jewish feminist circles. The Kabbalists want to unite Yahweh with his consort the Shekinah:
Shekhinah, the tenth sefirah, represents God’s presence in the world of “material reality” in which humans live. Shekhinah, the daughter of Binah, is a feminine sefirah whose role is to channel all the energies of the upper nine sefirot into the everyday human world. Without Shekhinah, humans would have no concrete understanding of divinity. Kabbalistic literature typically portrays that Shekhinah as an outcast, a lone sefirah. Her separation from Ein Sof and the other sefirot parallels the exile of the Jewish people from their homeland of Israel. Because Shekhinah is a part of Ein Sof, Ein Sof can never be whole or healed until Shekhinah returns from exile, just as Jews can never know peace until all Jews can return to Israel. Kabbalistic literature symbolically represents this return in the sexual union of Shekhinah and Tiferet, the sefirah that represents God’s beauty. Kabbalists all share the same aim: to unite Shekhinah with Tiferet through faithful devotion to Kabbalah, and in turn bring about the restoration of Ein Sof. https://www.sparknotes.com/philosophy/kabbalah/mini-essays/
1./ Of course wearing wigs in honor of the Egyptian Hathor and Canaanite Ashtaroth….https://t.co/NawOXrG4R5 pic.twitter.com/1zq6liVNwd
— The Tishbite (@Tishbite_redux) April 15, 2022
3./ It is not as though Israel came out of Egypt.. pic.twitter.com/Dotmbge2u7
— The Tishbite (@Tishbite_redux) April 15, 2022
In the practice known as Davening, the Jews copulate with the feminine aspect of “god” while praying.https://t.co/8vmkmpq9NK pic.twitter.com/5xvHOkcTyL
— The Tishbite (@Tishbite_redux) April 15, 2022
The Christian church has failed miserably in opposing transhumanism, tyranny, and war. There is only one Church and one body composing of Jews and Gentiles over the ages. No churches are without fault (doctrinal or otherwise) and yet Jesus is able to redeem faithful individuals even from the most corrupt churches (Rev 2:24).
“The Church failed on this issue massively. But not all of the Church. There were voices that spoke up.”
The Church Is to Blame for the Destructive Extent of the Mandates https://t.co/zOF5ZOSAJD
— Caldron Pool (@CaldronPool) April 12, 2022
One Lord, one faith, one baptism,
One God and Father of all, who is above all,
and through all, and in you all
(Ephesians 4:5-6)
There is only one flock and one shepherd.
These insights into Putin by Pieczenik might prove useful. Pieczenik was Deputy Assistant Secretary of State under Henry Kissinger, Cyrus Vance and James Baker. He served the presidential administrations of Gerald Ford, Jimmy Carter, Ronald Reagan and George H. W. Bush as deputy assistant secretary. On InfoWars Pieczenik boasted that he picked Putin:
"I reconstructed that mistake and I picked a man who worked for Andropov, the head of KGB named Vladimir Putin. Putin knows he was picked by me. He was specifically picked because he was East German intelligence. He spoke English, he spoke German, he spoke Russian, and Angela Merkel who has a PhD in nuclear physics knew him very well and could help control ..."
Steve Pieczenik on Putin: pic.twitter.com/11dl06gk7z
— The Tishbite (@Tishbite_redux) March 21, 2022
Pieczenik stated in April last year that Biden was no match for Putin.
OPUS 2021 2 The Uke Apr 12, 2021
Now whether or not Pieczenik can boast such influence his boss Kissinger certainly had some say in Cold War affairs.
https://t.co/5RENaEBO9S pic.twitter.com/hVZaGpv2rn
— The Tishbite (@Tishbite_redux) March 21, 2022
This is what Pieczenik says in his autobiography:
The Russian President Vladimir Putin [ex-KGB] has requested to meet me personally over the past two decades to explain to him how I planned and executed the successful coup detat against the Soviet Union in the late 1980s-90s. I have repeatedly refused to meet him. The real credit belongs to an elite team of intelligence officers, state department officials, and military officers - all of whom were involved in what I have affectionately labeled the "take-down of the Soviet Union". I would state that both Presidents Ronald Reagan and George H. W. Bush Sr. were the effective points of the multi-pronged spears that pierced the Soviet shield. One point I would like to continuously emphasize was the simple fact that I had endeavored to take down the Soviet machinery, not Russia, sui generis. I had learned a long time ago how formidable Russia had been during World War II, having sacrificed over three million brave men and women in order to defeat the Nazi war machine at Stalingrad in 1941. After I resigned from the Carter Administration for having refused to follow the president's orders, I received an invitation from Dr. Richard Solomon, the Director of the National Security Division at the RAND Corporation in Santa Monica, California. Over the years, Dr. Richard Solomon had become a dear close of mine. He had been Professor Lucian Pye's most influential student at MIT. He had become the Director of the RAND Corporation's National Security Division after having been one of President Nixon's key China strategists. From time to time, while I was still in the State Department, Richard had dared me to come up with a strategy that would effectively limit or neutralize the Soviet Union - America's principal enemy since WWII. After some reluctance on my part, I agreed to his offer of a RAND fellowship [CIA/MI/ DARPA funded] to outline both the strategy and the tactics for the eventual dismemberment of the Soviet Union. ... In the past several years, Putin correctly reprimanded me and my team for having created a dire financial and political situation in the breakup of the Soviet Union, wherein 23 million Russian citizens became so poor that they had no means to make a living and many starved to death. ... Soviet President Vladimir Putin has always wanted to "meet" the one man who took down the Soviet Union, Dr. Steve Pieczenik.
Putin’s book “First Person: An Astonishingly Frank Self-Portrait by Russia’s President” doesn’t mention Pieczenik but it mentions Kissinger (https://t.co/EPOaMOY9wW): pic.twitter.com/Lu7jbiGmlF
— The Tishbite (@Tishbite_redux) March 21, 2022
Whatever the case might be it looks like Putin was chosen for the role. He has a very close connection with Chabad and with the Jewish community and many of the Russian oligarchs are Jews. Moreover, he was a WEF Young Global leader under the Jewish Klaus Schwab and now he is fighting the Jewish Zelenskyy the Prime minster of the Jewish Soros controlled Ukraine. Is it so hard to believe that the Jew Kissinger and the Jew Pieczenik put him in place? Has Putin gone rogue and is he fighting the NWO or is he just fighting for his version of the NWO? There are no good guys. Putin is fighting for his own version of the NWO. In any case neither version wants free people with sovereign rights. We are seeing Russia, China and Iran being forced into a coalition against the West.
This video by Israeli news is pretty balanced if you ignore the comments about alien craft (lolz).
This is the 37second trailer…
Full version here: https://iconnectfx.com/view/aeb734f2-68a8-ec11-9969-0050568299de?mcvalc=en
My comment on the “alien craft”
They could be drones. They could be electrical-magnetic phenomenon. Until recently we did not even know sprites existed. Why do you always assume the least likely most sensational explanation? pic.twitter.com/u3kbjtNfgg
— Moses Hopes (@MosesHopes) March 21, 2022
There are no good guys in this picture. Look what is happening in the Ukraine (shocking footage of people being humiliated and tortured see the complete thread before it is censored). It is not the Russians who are doing this. Zelenskyy and his supporters are criminals.
This whole thread has been removed and suspended. It showed people being tied to lamp posts and being beaten on the bare buttocks and worse. These were ordinary citizens (including women and children) suspected to be Russian sympathizers. This is Zelenskyy’s democratic Ukraine. The thread has been replaced with pro-Ukrainian propaganda.
Thread. Hundreds of civilians have been punished for diverse reasons in Ukraine by paramilitary groups and National guard. Strong footage. Tortures, abuses, humiliation, even of kids and girls. pic.twitter.com/AbrwgKLVoc
— Juan Sinmiedo (@Youblacksoul) March 19, 2022
Stay true to your roots.
2./ Maxwell pic.twitter.com/gkquMmXzKU
— The Tishbite (@Tishbite_redux) September 24, 2021
4./ Maxwell or Unwell? pic.twitter.com/K1gAZ7JbfS
— The Tishbite (@Tishbite_redux) September 24, 2021
As Kevin would say…..
…..the Jew always comes thru…
The latest Kevin McCairn stream edited and split into three videos. The first is a short video expanding on the topic from the previous video: Global Prion Disease Treatment Market – Industry Trends and Forecast to 2028
Presence of a SARS-CoV-2 Protein Enhances Amyloid Formation of Serum Amyloid A
Second entry looking for E-protein (envelope protein)
=====================
/product=”envelope protein”
/protein_id=”UBC57849.1″
/translation=”MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCC
NIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV”
=====================
Paste sequence in PLAAC:
MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV
PLAAC: Prion-Like Amino Acid Composition
Another paper on amyloid formation:
Interactions between SARS-CoV-2 N-protein and α-synuclein accelerate amyloid formation
The following paper was published in Nature on 12 April 2021: Human ACE2 receptor polymorphism and altered susceptibility to SARS-CoV-2
"Among the variants tested, ACE2 K26R, consistent with its increased affinity for S-RBD observed in the biochemical assay, was the most effective (Ki 30 nM; ~33 fold greater than WT) in blocking viral entry (Fig. 5 and Table 1)".
"We also show that another ACE2 residue, K26, plays an important role in controlling the susceptibility to viral infections via a similar mechanism. Our structural analysis has suggested that K26R mutation will weaken coordination of the N90-linked glycan presumably interfering with its ability to shield the host from the viral infection. Our biochemical binding assays confirmed the predicted increased affinity for K26R ACE2 for S-protein. In fact, K26R ACE2 was the most effective among mutants tested for their ability to enhance viral entry, suggesting that this frequent polymorphism, very likely increases susceptibility to SARS-CoV-2 (Fig. 5 and Table 1)".
The above article in Nature says that K26R blocks the virus….in other words Ashkenazi Jews would be the most susceptible to covid. This goes completely contrary articles which state that the Jews are the least susceptible to covid such as this one: ACE2 coding variants in different populations and their potential impact on SARS-CoV-2 binding affinity. Look at the bar chart in the tweet below at the binding energy of K26R.
pic.twitter.com/uNL3mEApwz. — The Tishbite (@Tishbite_redux) September 23, 2021
We also have another study that states;
Amish (AMI) and Ashkenazi Jewish (ASJ) populations do not appear to carry such variants in ACE2 coding regions (Fig. 1b).
New insights into genetic susceptibility of COVID-19: an ACE2 and TMPRSS2 polymorphism analysis
So who is correct? A far as I am concerned anything published in Nature is suspect. The Indian author Somasekar Seshagiri works for Modmab Therapeutics Corporation is located in Foster City California and received a Coronavirus-related PPP loan from the SBA of $124,434.00 in April, 2020. Moreover, he went to the University of Georgia (in Athens, GA, US) where the Institute of Bioinformatics (founded 2002) with links to CDC has as director Jessica Kissinger. Now Kissinger is an unusual name. I am sure I heard it somewhere else (lolz). Is she related to Henry? Henry and his brother both have children and grand children. His mother (Mrs Kissinger) who died age 97 (Henry is 96 now) was survived by two sons, as well as six grandchildren and six great-grandchildren.
These authors contributed equally: Kushal Suryamohan, Devan Diwanji, Eric W. Stawiski.
Cardiovascular Research Institute, University of California San Francisco. The article they have just released was based on one that was written nearly exactly a year earlier (April 10, 2020). From memory this was about the time that the NYT posted an web article showing the complete genome sequence including 3D models of all the proteins. The one released a year earlier Human ACE2 receptor polymorphisms predict SARS-CoV-2 susceptibility says something similar:
"....and thereby potentially alter host susceptibility. In particular, human ACE2 variants S19P, I21V, E23K, K26R, T27A, N64K, T92I, Q102P and H378R are predicted to increase susceptibility".
It has many more authors (who seem to be have fallen away from this version): Eric W. Stawiski, Devan Diwanji, Kushal Suryamohan, Ravi Gupta, Frederic A. Fellouse, J. Fah Sathirapongsasuti, Jiang Liu, Ying-Ping Jiang, Aakrosh Ratan, Monika Mis, Devi Santhosh, Sneha Somasekar, Sangeetha Mohan, Sameer Phalke, Boney Kuriakose, Aju Antony, Jagath R. Junutula, Stephan C. Schuster, Natalia Jura, Somasekar Seshagiri.
This was a comment that I found under the article (the first one):
Comment: Ivan Shabalin
The paper describes an interesting idea, but the structural analysis and the predictions of the effects of the mutations are unsubstantiated and should be significantly revised.
For example, the presented analysis of the first mutation - K26R - has the following red flags:
- Figure 3b shows sugar labelled as "mannose", whereas the first sugar in glicosilated mammalian proteins should be N-acetylglucosamine (GlcNAc, or NAG), as it is in the crystal structures used for the analysis.
- The claim "We predict that K26R would abrogate stabilizing polar
contacts with N90, impairing coordination of the glycan (Figure 3b) and lead to an increase in the affinity of the virus to the ACE2 receptor" seems completely baseless. First, K and R are positively charged residues with similar lengths; I'm not convinced this mutation would necessarily abrogate the contact with NAG. Second, why would R form the predicted interaction with D-30? why not with Glu23, which is closer? Third, the following claim is very questionable "At the same time, R26 is now primed to establish backbone and side chain interactions with ACE2 D30 which then is poised to build a salt-bridge with CoV-2 RBD K417". In what way the proposed interaction R26-D30 would make D30 more prone to forming the salt bridge with K417? If anything, it would only decrease the strength of the bridge be being a "charge competitor". And, the salt bridge D30-K417 already exists in one of the structures they analyzed (6LZG).
Similarly, there are issues in the analysis of the second mutation:
- "The T27A mutant (Figure 3c) removes side chain-backbone and backbone-backbone interactions between T27 and E30 likely increasing the local dynamics of helix α1". First, there is a typo - it is E23. Second, the stability of a helix is mostly set by the C=O...N bonds between main-chain atoms, and the elimination of a side chain H-bond is unlikely to have a significant effect on the shape of the helix. Then, "This would allow the N-terminus of α1 to bend slightly and accommodate the unique CoV-2 RBD receptor binding-ridge loop that more intimately contacts ACE2 compared to its SARS-CoV counterpart" sounds very much unsubstantiated. To draw these conclusiong, MD simulations might need to be not perfomed.
Clearly, the analysis of other mutations is also questionable.
I believe that the Nature article is involved in a cover up.
Ashkenazi Jews and the Amish people are related and they carry a similar polymorphism not just on ACE2 but other genes. Moreover, Jews are less susceptible to respiratory disease. The paragraph below is from the blog article with the title: Bio-war race targeting (McCairn1).
A number of questions come to my mind. In the paper discussed by Kevin the Jews and the Amish have a similar genetic polymorphism that protects them from Covid. This means that the Amish and the Jews are related. The history of the Amish church began with a schism in Switzerland within a group of Swiss and Alsatian Mennonite Anabaptists in 1693 led by Jakob Ammann. Those who followed Ammann became known as Amish. … In the early 18th century, many Amish and Mennonites immigrated to Pennsylvania for a variety of reasons. Not only do the Amish share a polymorphism with Ashkenazi Jews that makes them resistant to covid they share genetic loci for myopia (Fine-mapping of candidate region in Amish and Ashkenazi families confirms linkage of refractive error to a QTL on 1p34-p36). Anabaptists and Jews have had interactions for several centuries, since the origins of Anabaptism in the Radical Reformation in early modern Europe. Due to the insularity of many Anabaptist and Jewish communities, Anabaptist–Jewish relations have historically been limited but there are notable examples of interactions between Anabaptists and Jews. Due to some similarities in dress, culture, and language, Amish and Mennonite communities in particular have often been compared and contrasted to Hasidic Jewish communities (Wikipedia).The Mennonite Metzler family, tracing their lineage of descent through Valentine Metzler, a German immigrant who arrived in Lancaster County with his father Jacob in 1738, has close Y-DNA matches to Jewish families such as Kronik (in Belarus), Cohen and Langer (in Ukraine) and Friedman and Wengrowski (in Poland). [Anabaptisthistorians]. So, that solves that mystery. At some stage Ashkenazi Jews and Annabaptists must have interbred in Europe.
Not just the study cited by Kevin but this one also presents a similar finding:
Here, we have analyzed the genetic markers of the TMPRSS2 gene and the differences in their alternative allele frequencies (AFs) among populations to identify possible susceptibility loci to COVID-19 and to correlate them with disease epidemiology. *AF= alternative allele frequencies (AFs). Regarding the non-synonymous pathogenic variants, we observed the highest AF among the Ashkenazi Jewish (ASJ) population (Figure 1A), while the Finnish (FIN) showed the highest AF among European subpopulations (Figure S2A).
Genetic Analysis of the Coronavirus SARS-CoV-2 Host Protease TMPRSS2 in Different Populations
And this article from 2009:
DENVER — Researchers at National Jewish Health and the University of Colorado Denver have discovered a gene that is associated with improved survival among patients with acute lung injury. Acute lung injury (ALI) is often caused by a respiratory infection and results in low oxygen levels in the blood, and fluid in the lungs. It is one of the most vexing problems for intensive care units, afflicting almost 200,000 people in the United States each year, and killing 40 percent of them. https://www.nationaljewish.org/about/news/press-releases/2009/acute-lung-injury
And this paper:
The K26R (rs4646116) variant is an ACE2 variant that facilitates the binding of the S-glycoprotein effective in binding the coronavirus to the host cell and increases the susceptibility to the virus. The K26R variant, which reduces virus binding to the ACE2 receptor, has been found to be more concentrated in the Jewish population (1.2%) and, in contrast, the Asian population has the lowest allele frequency for the single nucleotide variant encoding K26R*
* Al-Mulla F, Mohammad A, Madhoun AA, Haddad D, Ali H, Eaaswarkhanth M, et al. A comprehensive germline variant and expression analyses of ACE2, TMPRSS2 and SARS-CoV-2 activator FURIN genes from the Middle East: Combating SARS-CoV-2 with precision medicine. bioRxiv 2020
Effects of Human Genetic Factors (Ethnicity and Race) on Clinical Severity of SARS-CoV-2 (COVID-19)Journal of Experimental and Basic Medical Sciences 2020;1(3):147-158
This website is not partisan. I do not vote and never intend to vote. I do not promote political movements but I do offer social commentary and expose hypocrisy. So it is without any apologies that this is brought to your attention because we are treading a well worn path. It is the same path that was trodden before WW2. The same people are behind it, using the same tactics to cause mayhem and bloodshed.
Some might say that they lack imagination…can’t they think of something new? Actually, they don’t need new strategies because people are dumb and they never seem to learn. They repeat the same mistakes. If the pandemic has taught me anything, it has taught me how stupid people are.
The article was inspired by Dr Kevin McCairn being interviewed by David Hiscox a mild mannered middle-class Australian (in Victoria) piano teacher and neo-Nazi (lolz). Before we begin…if you answer yes to any of the below you are probably far-right, a terrorist or a Nazi:
I could add more to that list but if you answered yes to any of the above you are well on the way to becoming a terrorist. You probably need to attend re-education camps.
Before we proceed any further I will offer my bona-fides and that of Dr Kevin M’cCairn. People who know me know that I have mixed race children and so does Kevin (Japaneses/Pakistani). That can hardly qualify us as “racist” white supremacist bla, bla, bla. This is not about skin color but about culture, values and character. The hypocrisy of the situation is that the Jews promoting diversity and multiculturalism etc are the most inter-married, in-group, in-bred, group-preference people on earth. They earnestly believe that they are superior and it is their due to rule the inferior races. Never forget that it was white Christians who abolished the centuries old practice of slavery.
So, putting that to one side I was intrigued to learn that Kevin had been pilloried in the British Gutter Press for giving a 25 GBP donation to BNP (British National Party) which he did after Islamist’s hacked off the head of Lee Rigby in the middle of the street where he lived at the time. His academic career in the woke institutes took a nose dive after that incident.
I lived and worked in the UK for many years and loved West Yorkshire and the people. However, I saw it gradually deteriorate as areas became “ghettoized” causing “white flight” as people moved out of the urban areas in search of decent schools. I saw the march of Common Purpose Marxism through the education system, the police and the judicial system. I saw Muslims practice child grooming and pedophilia rape gangs. I saw the police turn a blind eye. It took years and immense public pressure before arrests and prosecutions were made. That is waaycist you see. And this was to the detriment of decent law-abiding and upright Muslims that were my friends and work colleagues. Everyone suffers when justice is not done, when “fictive reality” becomes the norm.
Did anyone ask why the UK was flooded with refugees? Why Europe was flooded with refugees? That was done on purpose. They money men and the deep state shattered the Middle East to create Greater Israel and the Bridge and Road. They knew that refugees would flood into Europe and destroy centuries of culture. The great replacement had begun. In order to build the MacKinder world Island they need to make you feel guilty over your ancestry. You need to bow the knee because you are white. Yet their race based weapon (Covid19) targets whites and blacks (Ashkenazi Jews or Chinese to a lesser extent). They only care about themselves. They are the only ones fit to rule the world. It was promised to them.
How many of these “nationalists” groups have been penetrated by (very dumb) “intelligence assets”. It is a well worn tactic. The FBI does it all the time. They even recruit mentally retarded people and give them bomb -making material. Ahaa….we caught them in the act. How many of the atrocities that we see are staged false flag incidents? We will never know but I no longer trust stories like the Christ Church shooting which led to gun-confiscation laws just before the “pandemic”. So many of these incidents are “false flag” operations. How about Port Arthur? I honestly don’t know but it is all so suspicious.
David Hiscox is a middle class piano teacher who is trying to fight the great replacement. This is not about “white supremacy” but the fact that people want to be left alone to work and live and enjoy their own community. A nation is based on family.
"You either have a a strong patriarchy, you know strong families strong dedication to God and a strong nation or you have a globalist empire (battle one) or you have just chaos..."
One of the NSN (National Socialist Network) members (Dave Ryan) drove a car and trailer around Adelaide with racist slogans and NSN stickers upsetting people. Channel Nine filmed the guy and 60 minutes did a hit piece on nationalists, racists Nazis, Jew hating white supremacists. Can you see what is happening?
It sounds to me a bit like what they did with Brendon O’Connell although Brendon was never a member of any group.
I am not promoting David Hiscox but I think it is important to know both sides of the story. To this end I place two articles warning everyone against the evil neo-Nazis. Every word in these articles is true (sic). So, I place both sides of the story below and also a link to their website. I am a great believer in censoring nothing….especially when so many lies are being told. I think that people who can think critically and do research should make up their own mind.
But remember this…..extremism begets extremism…and unrighteousness begets unrighteousness…and lies begets lies…and those who live by the sword will die by the sword. In God’s view we are all sinners. No one is superior. The Jews (who were elect) got taught a powerful lesson when God brought Gentiles into covenant relationship. They never got over it.
It is quite obvious that the socialistic corporations do not want individualism or freedom. Only “terrorists” hold such extreme ideas as family first. You must be subject to the corporate state. Even your body. Even your kids. And no in-group preference (unless you are Jewish).
— Moses Eleftheria (@EleftheriaMoses) August 28, 2021
Make up your own mind
The website = https://xyz.net.au/
Right Wing Extremism
Just a short video from Wake Up Australia. Great work exposing another psyop run by Avi Yemeni the Australian Jew (Zionist) a Melbourne-based social media personality and gym owner. As an adult Yemini moved to Israel, gained Israeli citizenship, and became a sharpshooter in the Israeli Defence Force (IDF) serving with the Golani Brigade from 2005 – 2008. Most of his active duty was spent in the Gaza Strip. Avi Yemini is the Australian Bureau Chief for Rebel News which is associated with Canadian (Jewish) lawyer Ezra Levant, who in turn is associated with Tommy Robinson (not his real name) with his anti-immigration stance. Now Tommy gained ground because of the Muslim child grooming and rape scandals in the UK and because of the unregulated mass immigration. Tommy is also a Ziomist and knows Avi. Tommy has photographs of himself standing on an Israeli tank.
For an article:https://t.co/YNAlZwQ6hm
— Moses Eleftheria (@EleftheriaMoses) August 11, 2021
Who remembers this from last October?
The greatest balls up in Psyop history.
Avi Yemini once again instrumental.
Yet the sheep fell for it.
First video is from Peekay Truth
The 2nd video was from research from myself and Ana did last year.
A great video on this was by tell them they’re dreaming
Watch here (https://youtu.be/w3t6AhUpgZU)
You are in a bio-war and a psychological war. Tommy Robinson in the UK made some very valid points. The police did turn a blind eye to criminal activity involving Muslims. I know, because I lived in Huddersfield for many years. Eventually the gang was brought to justice because of mounting public pressure. The police were captured by Common Purpose (cultural Marxism diversity etc) and dare not lift a finger.
The point is that the whole thing is a psyop. The Jews (the neo-conservatives in the USA) helped Israel destroy and balkanize the middle east. The Muslim refugees fled to Europe looking for stability (who can blame them?). Then the “far-right” reacts (Tommy Robinson). This is pure Hegelian Dialectic. Problem, reaction solution.
The problem was created by the Jews. They want you to understand that nation states are a failure. The family unit is a failure (to be replaced by the State and corporate guardianship). Competing governments are a failure. We can’t even stop climate change or a pandemic, or pollution or refugees (mass migration) or poverty….so…..
The Jews also have the Solution…..one world Government…run by…ta ,da….the Jew. If only we had more Jews and bankers in charge (same thing) then everything would be OK. Look, I have nothing against a Jew running the world as long as it is Jesus Christ. You know, the same Jew who turned around and said your father was a liar and a murder from the beginning. Yeah, that one.
This notification is for new visitors. I believe the Jewish people have been betrayed by their elite. This is exactly what happened in the first century when aristocratic priests under a foreign Edomite client King (Herod) backed by religious zealots (Pharisees) in collaboration with Roman power sold out the “publicans and sinners” who heard Jesus gladly. They are Ruthless leaders as I made apparent in this article:
Ruthless leaders
They have betrayed the Jewish people as I make apparent here:
Christian -Zionists are the enemy of truth. They are deluded. God did not command the Jews to conquer the land; it was an imperialist Rothschild project. The descendants of Abraham are those who do the WORKS of Abraham (John 8:39) {Abraham’s work was the offering of Isaac…it was an ACT of messianic faith- in so doing he kept the “whole law” even before it was given Gen 26:5).} Israel is the Great Harlot and the beast system is controlled by the Jewish elite. They have even betrayed their own people like they did in the first century. They are not “the Israel of God” and they are about to be punished. Deluded Christians need to wake up.
Israel is a Redshield project. It would not surprise me if that family descended from Edom.
Like I have said, (The Terrorist Regime running Modern Israel is “NO” Friend of the United States).
— Ricardos Travels (@RicardosTravels) May 28, 2021
Modern Israel was illegally proclaimed a state by Terrorists (after killing 100s of US & US Allies), their Irgun Terrorist leader became PM of Modern Israel. https://t.co/9peh9SzmDZ
In November 1990. What are you doing to hasten the Messiah? (lol) I am doing…I am doing…
Whatcha doin Bibi? Preparing for 9/11? Fine tuning the Yinon plan? Compromising politicians? Back-door-ing chips and infra structure? Transferring tech to Russia and China? Whatcha doin?
Whatcha doin? pic.twitter.com/e40C2k0LPY
— Apu San (@SanApu) May 28, 2021