K26R Threats

K26R Threats

Dr McCairn is preparing the location for his experiment which he is doing on a shoestring.  In the meantime he has established the WTYL platform and is streaming.

NATO Up’s Nuclear Ante, K26R Threats, Latest CWD Narrative Injection, & The Great Dumbing (3:41 mins)

RFK Ashkenazi

RFK Ashkenazi

I called this three years ago. Chabad is behind this funded by Rothschild. Avril Haines the DNC is Hassidic and went to Georgetown University as did Katz and Hotez. Haines was at Event 201 together with George Gao from the Chinese CDC. The FCS encodes 72 as does Covid 19 and Gentile. There are 72 gentile nations (LXX Gen 10). The rule of 72 is a quick way to calculate compound interest. Ashkenazim are protected. K26R . The 26 letter of the alphabet is Z. KZR (kazar) probably an in-joke. The name of God in the Hebrew has a value of 26. This is the work of Kabbalists (Gnostics) and their alchemist scientists who are anti-Christian and hate the goy especially the white race because they think we have usurped their rightful place. I told everyone three years ago that a section (not all) of the Jews were behind it supported by the Old East India Company (Anglo-Zionists) and corrupted Christian-Zionism (which is a religious oxymoron like Judeo-Christianity). The bankers (Rothschild et al) do not care about religion. If anything, they are Satanists, but they will use Lubavitcher fanaticism to achieve their goal of global dominance. PS The vaccine was meant to be kept at -72 Celsius. What happened to that?😂 Do you see it yet??

 


 

Streaming with Adam Green

Streaming with Adam Green

This was a  very good scientific explanation building a circumstantial case step by step demonstrating that the pandemic was not an accident and pointing a finger at the culprits. I have added a rough transcript (my own notes) underneath and made my own video responding to the metaphysical and historical questions.

Streaming With Adam Green (Know More News): The K26R Hypothesis (3:24 min)

Articles

ACE2 Coding variants in different populations and their potential impact on SARS-CoV-2 binding affinity

https://www.sciencedirect.com/science/article/pii/S2405580820301072

New insights into genetic susceptibility of COVID-19; an ACE2 and TMPRSS2 polymorphism analysis
https://bmcmedicine.biomedcentral.com/articles/10.1186/s12916-020-01673-z

Gain of Function COVID-19, SARS and Bats Coronoviruses Genomes Unexpected Exogenous RNA Sequences
https://www.researchgate.net/publication/341756383_COVID-19_SARS_and_Bats_Coronaviruses_Genomes_Unexpected_Exogenous_RNA_Sequences

Rough Transcript

16- Start
18- Adam calls John Brisson a Zionist Agent (lolz)
22- main goal eradicate all foreign gods and get everyone to worship him and he has a nation of priests and it it is their responsibility to get everyone to worship their god – the Messiah to subdue the nations
23-Kev Super-ordinate consciousness why Jewish?
25- E. Michael Jones
26-Jones acknowledges that Judaism before the NT was the one true religion just fighting over the soils, Kev-armagedon fetish
27-Jones cites a Jewish historian that says that Christianity was the motr successful Jewish sect and it conquered the Roman empire- form of warfare
28- 911 -continuation of that with Bio warfare lockdown and new technology
29-K26R -Israel first mover (Adam) Kevin: not a monolith willing to harm their own
30 -Adam -hastening end with plagues Kev- threat assessmen-
31- Data summary
31- mentions Charles Lieber -Kev -neuroscience brain machine interfaces not involved with the WIV but based in Wuhan
32- got off lightly for tax evasion thousand talents program academics to go to China-he was not declaring income
34-Adam: Lab origin- called conspiracy theorist
35-Kev tells his story in South Korea – his illness and the dective work Daszak,metabiota etc
36- ask Adam you know why that happens on 911 -reply Anthrax- Adam -Fort Dietrich. Amerithrax
38-Biowarfare research ramped up and te first SARS emerged. Biowarfare industry born -grants etc.
39- Kev Best case scenario accident worst case-they pulled the trigger
40-Israel not signed biowarfare or nuke treaties non-signatory also USA stopped honouring after after 911
41-kev,our main threat actors
A.China
B. Us and 5 eyes countries
C. Ashkenazi genetics
D. WEF -corporate type trans national groups.
42-Kev the release of the emails etc
43-Adam question about Ashkenazi fingerprint
44- Kev ACE2 coding
45-Kev description of invective process and binding energy
47-Adam question about Neanderthal genes which is why India high and got hit hard
48-In silico test -European roughly 10X more attracted
49-K26R and East Asian lowest binding affinity
50-the virus rotating image -loop structure peptides, variable loop structures similar to different clades of HIV.
52-Adam -random? Kev: Multiple clades GAG and GP-HIV120
54-Adam Fake viruses? Kev- environment seeded with disinfo. Psychological warfare.
56-Kev nanopore reads sequences consensus sequence.
57-Iran hit hardest (no 5G towers)
58-FCS far wider tissue tropism
59-Luc Montigner Prions
60-New insights paper-
1:01-serian protease and cleavage site
1:02-Adam: Ashkenazi Less susceptible in two different ways.
Discussion is it coincidence? Very unlikely two. Just some Ashkenazi have it. They intermarry a lot.
1:04-Kev: Two regions, two advantageous polymorphisms
1:05-Omicron mild -Ashkenazi have a stronger binding.
1:06-Less pathogenic version – natural antibodies-broad natural immunity
1:07-they are not vaccines (LAV) but a transfection
1:09-Pseudouridine, distribution etc
1:11-LNP to ovaries
1:13-Menstrual cycles
1:14-Kev Mad Cow-Prion disease
1:15-Albert – the older (Esau/Edom) serve the younger. Allegory Gentiles will seves the Jews
1:19-Albert CIA Fauci (NIH) meeting
1:20-Patterns in the data
1:22-Adam – Why would God make viruses?
1:23-Kev -virome we are covered in viruses-ticks,misquites
1:24-Albert -Adam foremost Authority on the psyop.
1:26-connect the dots – unless you are close minded -Jewish hoax
1:28 Adam -no viruses –
1:32-Adam and Albert talk (Kev edits)
1:34-Antisemitism meeting with Musk
1:35-Adam Freedom of religion and blasphemy laws
1:38-Albert-truth police/constitution/narrative control -they want to avoid conversation…censorship
1:39-Albert behind two WW and Kennedy assassinations and 911
1:44-E Michael Jones – one you convert to Christianity the Jews take over your culture. Not having children (Japan)
1:45-planting seed in fertile soil (nation of Islam)
1:48-Rothschild intermarriage
1:49-Mad Cow clip
1:51-Adam-feeding cows to cows
1:52-Chronic Wasting Disease in USA tick borne
1:53-Plum Island
1:56-protein fragments and misfolding
1:59-Albert military use Kev yes but Alzheimer etc
2:01-Article 20 amino acid sequence intiating most extreem of neurological disordrs
2:04-Adam question-is Israeli involvement with covid suspicious
2:05-Kev warning -no safe dose of prion protein
2:07-Adam what do we know about bioweapons? Paper-trail?
2:08-Kev extensive. Israel project coast. South Africa and Israel.
2:09-Tight homogenetic group easier to target outsiders
2:12-A binary system to maximize effect -vaccine and pathogen
2:14-Going for systems collapse
2:15-CDC Data
2:18-Neurological damage Alzheimer, Dementia
2:20-Kev thinks the job is done
2:21-Covid was the next round. Financial collapse next
2:23-Albert and Adam -not taking vaxx from anyone calling me Amalek (lolz)
2:24-Compare with Bolshevism – not through worker but medical
2:26 Albert: What happens when people realize vaccine is killing more than virus?
2:28-Long hauler accelerated aging
2:29-Adam leaves Albert what to look out for?
2:30-Increase in disability. Albert where are we increasing or decreasing? Kev:Going up.
2:33 Young people dying and sick
2:35 Fight back legally etc
2:36-incapacitated
2:37-UBI introduced
2:39-We were much better with the Romans and Greeks
2:40-I don’t know we might have ended up the same
2:43-Albert: It looks like we are being set upmto be destroyed in the West. In Russia thry banned sex change
2:44-Kev 30 million people not here anymore
2:45-Kev antecdote about Austria girlfriend grandma went to school with Adolf
2:47-Albert-What is the average sheeple to do?
2:48-Albert: They want to gut our constitution
2:50-Albert:Minimize deep state-permanent government
2:51-Kev asks about Trump embassy to Jerusalem was that prophetic in their framework
2:52-what about Zohar 911 prediction?
2:53-Albert: Trump a Zionist Sheldon Adilson. Trump released Pollard and recognized the Golan Heights.
2:55-Kev- ZOG has a choke-hold.
2:56-Albert- The English did their servitude for te parasite and now US turn
2:57-Finance-fiat backed by power
2:58-Albert- prepare with prepping
3:02-Albert – The British – British Israelism 1666 Zevi+Great Fire and Law of salvage -Maritime law. 1656 -Cromwell let the Jews back in
3:04-Albert Library of Alexander burning down
3:05-Early Christians ho were basically Jews burnt the library
3:06-Discussion about religion and race:Good Samaritan
3:07-Albert-all you need is the Golden Rule and family
3:08-Albert: Maybe worship a God that does not want to mutilate (Circumcise) you
3:14- Super ordinate consciousness. Science does not have everything figured out (evolution)
-we don’t know what we don’t know. They want to pick up history at Sumer -5,000 years or 6,000 years ago
Our early history has been hijacked -discussed with Paul -cycles etc. Underground cities etc Gobleki Tepe buried deliberately. Cave complex in Turkey (Capodecia) catastrophes. Punctuated by cataclysm. Floods etc. Best strategy to get past the event horizon..maybe Jewish way. Misanthropic, supremacist
3:20- Albert is going to deconvert me (lolz)

Response (28 min)

 

Red Pilling Normies

Red Pilling Normies

I can’t keep up with Dr Kevin McCairn.  Listening to this live stream while I type this (it is live) and very good.  Still to watch the video below this one.  Oy Vey!

Quote by Dr McCairn: We have come to deify scientists as priests.

See my article on K26R polymorphism and Race biowarfare:

Bio-war race targeting (McCairn1)

The Missing Link – Interview With Jesse Hal (LIVE)

Blinken OK’s Nuclear War, Dr Engler PANDA Ostrich, Proximal Implosion, MENPS For Brain Disorders (3:12)

RFK JR SPEAKS OUT

RFK JR SPEAKS OUT

The issue of ethnic targeting or race based warfare was addressed by Dr McCairn and by this website in July of 2021 (see article below). Search for K26R to find other articles on this website if you want to track the development.

Bio-war race targeting (McCairn1)

JFK Jr is taking flak because he mentioned a scientific article that demonstrated that  bio-weapons are race targeted and there are certain advantageous polymorphism such as K26R that make the ACE2 receptor less likely to bind to the Receptor Biding Domain (RBD).  So certain races will get less sick. The races and subgroups that have this advantage are the Ashkenazi Jews, the Amish, Finish and Chinese.  Of course it is not the Amish or Finish that is upsetting people but the mention of Ashkenazi Jews which is of course “antisemitic” and Chinese, which is “racist  Sinophobia (lolz).  The Amish seem to originate from the same European regions as the Ashkenazi and at some point must have intermingled, similarly the Finish and Chinese share mongoloid ancestry.  Since then other scientific articles have appeared which seem to support this finding.  Facts are facts and scientific hypotheses need to be reviewed and tested against real time epidemiological data.  The Jews are not homogeneous because there are Sephardim and Ashkenazim and many sub-groups. So some Jewish groups will be affected more than others. Moreover, I pointed out the connection between Chabad and 72 at the end of March 2020:

 

Is this coincidence, a PsyOp or very clever biological engineering (GOF)?   Has a certain contingent (sub-group) of Ashkenazi  Jews funded (Rothschild) and engineered this or have they been set-up?  A set-up seems unlikely as Pharma and the media is run by the Jews and they pushed the vaxx.

Here is my problem

RFK squirms in this interview trying to demonstrate his credentials as a Zionist supporter. All American politicians act the same way because the Jewish lobby is extremely powerful.  That said, I have a feeling that RFK  is playing the game and going through the motions because he probably suspects (knows?)  that the Jews had a big hand in the assassination of his uncle and his father.  A great game is being played.

RFK JR SPEAKS OUT Against Democratic Attempts to SILENCE Him At Hearing: Rising Interview (31 min)

 

It’s All Over! (Democracy That Is) – Peak Prosperity Podcast (20 min)

 

Race Based Biowarfare

Race Based Biowarfare

It is a SHTF moment as what we have been saying for two years is now being revealed -race based bio-weapons.    K26R is the polymorphism that advantages Ashkenazi Jews.

RFK Jr Supporting Evidence For Ethnic Disparities In COVID Outcomes – Race Based Biowarfare (1:20)

Starts at 15 min

Anti-NeoCon Report With Ryan Dawson – Race based Biowarfare (K26R Hypothesis) –[2:24 min]

official start at  13 min

 

Well, well,well – K26R

Well, well,well – K26R

Race based Warfare

I wanted to put this up yesterday but was so busy.  We have been warning about bio-warfare and K26R for two years and now RFK jr. is talking about it.  

RFK and antisemitism

We were right again.  Starts at 13 minutes.

Well, well, well…

RFK Jr – Lases Chinese & Ashkenazi Jews For COVID-19 Race Based Bio-Warfare (With Charles Rixey)-[2:10]

RFK and antisemitism

RFK and antisemitism

Do I trust RFK Jr? Nope.  A great game is being played and our heroes are being given to us….RFK on the left and Trump on the right.  The good Zionist Jews vs. the Evil globalist Jews  (lolz).  It is all set-up for the next phase which is the collapse of everything.

Smear Job On RFK jr., Glenn Greenwald & Jimmy Dore Turns Out Funny! (6 min)

The Chosenites

The Chosenites

This is Erik Weinstein the brother of Brett Weinstein from the Dark Horse Podcast. Erik Weinstein received his PhD in mathematical physics from Harvard University in 1992.He was a a former joint managing director for Thiel Capital. So he his connected to the “right-wing” transhumanist Peter Thiel (from Frankfurt probably Jewish connected to Rothschild) the billionaire behind Plantir the company that specializes in big data analytics. I remember the cringe worthy interview that Eric Weinstein gave trying to exonerate his visit to the Epstein Mansion. During this clip he mentions the power of the sun a reference to the Teller Ulam designs for H-Bombs.The H-bomb is 1000x more powerful than the A-bomb and the reference to the sun is because it uses Hydrogen fusion like the sun. An atomic bomb uses either uranium or plutonium and relies on fission, a nuclear reaction in which a nucleus or an atom breaks apart into two pieces. To make a hydrogen bomb, one would still need uranium or plutonium as well as two other isotopes of hydrogen, called deuterium and tritium. The hydrogen bomb relies on fusion, the process of taking two separate atoms and putting them together to form a third atom.

Stanisław Marcin Ulam was from a wealthy Polish Jewish family of bankers, industrialists, and other professionals and Ede Teller was born on January 15, 1908, in Budapest, Austria-Hungary, into a Jewish family. Of course, without Einstein and the other Jewish scientists we would not have the power to destroy ourselves.

Chosen to unleash the power of the sun (4 min)

Are we supposed to say “thank you”? The Jews are helping make the earth uninhabitable so that we can become an intergalactic species? (lolz). So many planets to blow up and so little time. The Jews do seem touched by God and they have exceptional abilities but they also display narcissistic psychopathy and neuroticism. That reminds me of a quote by another Jew (Oscar Levant): “There’s a fine line between genius and insanity. I have erased this line.”

The fundamental problem with humanity is human nature and we will take that nature with us wherever we travel in the galaxy. Interesting that God should chose such a narcissistic,stubborn self-absorbed, brilliant people as a vehicle through which to display his mercy as they seem to have wholly given themselves over to rebellion and the dismantling of his creation. Despite his chastisement they are unrepentant and unswerving in their drive to make of themselves transhuman gods. The irony is that Eric Weinstein is partially correct as humanity will be reformed and transformed by a Jew that they rejected.

So, we must rely on the cold calculating transhumanist logic of Jewry (Spock) to escape the prison of this body and prison planet and become an intergalactic species to live long and prosper.  The ultimate irony is that the Spock greeting is based on the rabbinical El Shaddy blessing with his hand forming the shape of the Hebrew Shin ש‎ (sh).  The promise of the Shaddy name was the blessing of fruitfulness and progeny   e..g., lots of descendants – the very thing that causes these Jewish eugenicists so many problems.  The irony is in my view exquisite.   The very blessing of fecundity causes the problems as it did originally in Egypt with too many Hebrew babies being born.   The Egyptian solution was to kill the male babies and enslave the Hebrews. 

They have learnt nothing from their history.  The problem is not overpopulation it is their faithlessness.  Their grasping at divinity. Take this to heart;  I said ye are gods but ye shall die like men (Psalm 82:6-7 repeated by Jesus in John 10:34).  It is the Jews with their scientific brilliance and acumen who are behind the GOF virus.  They left their fingerprint on the virus as the Furin Cleavage Site has a gematria value of  72.

 

Moreover, the  K26R polymorphism gives some Ashkenazi Jews an advantage. The K26R variant is produced by the minor allele of the rs4646116 SNP. On gnomAD v2 only 1.2% of Ashkenazis have the minor allele.

Basically only 1% of the 1% therefore not all Ashkenazim but a minority of a minority. Those who possess the power and the funding to subvert nations, start wars and corrupt science. They are obsessive and dangerous and willing to sacrifice their own fellow countrymen to achieve their ends.   So not all Jews are involved but only certain dynastic families that have psychopathic tendencies.  They do not get to build the New World Order based on their lies and deception.

CJD, Amyloid and K26R

CJD, Amyloid and K26R

The latest Kevin McCairn stream edited and split into three videos.  The first is a short video expanding on the topic from the previous video:  Global Prion Disease Treatment Market – Industry Trends and Forecast to 2028

Mad cows or crazy people? (5 mins)

Amyloid plaques (1 hour)

Resources

Presence of a SARS-CoV-2 Protein Enhances Amyloid Formation of Serum Amyloid A

GISAID Initiative

NCBI Sars CoV-2 Resources

Second entry looking for E-protein (envelope protein)

=====================
/product=”envelope protein”
/protein_id=”UBC57849.1″
/translation=”MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCC
NIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV”
=====================
Paste sequence in PLAAC:

MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV

PLAAC: Prion-Like Amino Acid Composition

Another paper on amyloid formation:

Interactions between SARS-CoV-2 N-protein and α-synuclein accelerate amyloid formation

 

ACE2 and the JEW: K26R to bind or not to bind that is the question? (15 min)

The following paper was published in Nature on 12 April 2021: Human ACE2 receptor polymorphism and altered susceptibility to SARS-CoV-2

"Among the variants tested, ACE2 K26R, consistent with its increased affinity for S-RBD observed in the biochemical assay, was the most effective (Ki 30 nM; ~33 fold greater than WT) in blocking viral entry (Fig. 5 and Table 1)".

"We also show that another ACE2 residue, K26, plays an important role in controlling the susceptibility to viral infections via a similar mechanism. Our structural analysis has suggested that K26R mutation will weaken coordination of the N90-linked glycan presumably interfering with its ability to shield the host from the viral infection. Our biochemical binding assays confirmed the predicted increased affinity for K26R ACE2 for S-protein. In fact, K26R ACE2 was the most effective among mutants tested for their ability to enhance viral entry, suggesting that this frequent polymorphism, very likely increases susceptibility to SARS-CoV-2 (Fig. 5 and Table 1)".

The above article in Nature says that K26R blocks the virus….in other words Ashkenazi Jews would be the most susceptible to covid. This goes completely contrary articles which state that the Jews are the least susceptible to covid such as this one: ACE2 coding variants in different populations and their potential impact on SARS-CoV-2 binding affinity. Look at the bar chart in the tweet below at the binding energy of K26R.

We also have another study that states;

Amish (AMI) and Ashkenazi Jewish (ASJ) populations do not appear to carry such variants in ACE2 coding regions (Fig. 1b). 
New insights into genetic susceptibility of COVID-19: an ACE2 and TMPRSS2 polymorphism analysis

So who is correct? A far as I am concerned anything published in Nature is suspect. The Indian author Somasekar Seshagiri works for Modmab Therapeutics Corporation is located in Foster City  California and  received a Coronavirus-related PPP loan from the SBA of $124,434.00 in April, 2020. Moreover, he went to the University of Georgia (in Athens, GA, US) where the Institute of Bioinformatics (founded 2002) with links to CDC has as director Jessica Kissinger.   Now Kissinger is an unusual name.  I am sure I heard it somewhere else (lolz).  Is she related to Henry?  Henry and his brother both have children and grand children. His mother (Mrs Kissinger) who died age 97 (Henry is 96 now)  was survived by two sons, as well as six grandchildren and six great-grandchildren.

These authors contributed equally: Kushal Suryamohan, Devan Diwanji, Eric W. Stawiski.
Cardiovascular Research Institute, University of California San Francisco.  The article they have just released was based on one that was written nearly exactly a year earlier (April 10, 2020). From memory this was about the time that the NYT posted an web article showing the complete genome sequence including 3D models of all the proteins.  The one released a year earlier Human ACE2 receptor polymorphisms predict SARS-CoV-2 susceptibility says something similar:

"....and thereby potentially alter host susceptibility. In particular, human ACE2 variants S19P, I21V, E23K, K26R, T27A, N64K, T92I, Q102P and H378R are predicted to increase susceptibility". 

It has many more authors (who seem to be have fallen away from this version): Eric W. Stawiski, Devan Diwanji, Kushal Suryamohan, Ravi Gupta, Frederic A. Fellouse, J. Fah Sathirapongsasuti, Jiang Liu, Ying-Ping Jiang, Aakrosh Ratan, Monika Mis, Devi Santhosh, Sneha Somasekar, Sangeetha Mohan, Sameer Phalke, Boney Kuriakose, Aju Antony, Jagath R. Junutula, Stephan C. Schuster, Natalia Jura, Somasekar Seshagiri.

This was a comment that I found under the article (the first one):

Comment: Ivan Shabalin

 
The paper describes an interesting idea, but the structural analysis and the predictions of the effects of the mutations are unsubstantiated and should be significantly revised.

For example, the presented analysis of the first mutation - K26R - has the following red flags:

- Figure 3b shows sugar labelled as "mannose", whereas the first sugar in glicosilated mammalian proteins should be N-acetylglucosamine (GlcNAc, or NAG), as it is in the crystal structures used for the analysis.

- The claim "We predict that K26R would abrogate stabilizing polar
contacts with N90, impairing coordination of the glycan (Figure 3b) and lead to an increase in the affinity of the virus to the ACE2 receptor" seems completely baseless. First, K and R are positively charged residues with similar lengths; I'm not convinced this mutation would necessarily abrogate the contact with NAG. Second, why would R form the predicted interaction with D-30? why not with Glu23, which is closer? Third, the following claim is very questionable "At the same time, R26 is now primed to establish backbone and side chain interactions with ACE2 D30 which then is poised to build a salt-bridge with CoV-2 RBD K417". In what way the proposed interaction R26-D30 would make D30 more prone to forming the salt bridge with K417? If anything, it would only decrease the strength of the bridge be being a "charge competitor". And, the salt bridge D30-K417 already exists in one of the structures they analyzed (6LZG).

Similarly, there are issues in the analysis of the second mutation:
- "The T27A mutant (Figure 3c) removes side chain-backbone and backbone-backbone interactions between T27 and E30 likely increasing the local dynamics of helix α1". First, there is a typo - it is E23. Second, the stability of a helix is mostly set by the C=O...N bonds between main-chain atoms, and the elimination of a side chain H-bond is unlikely to have a significant effect on the shape of the helix. Then, "This would allow the N-terminus of α1 to bend slightly and accommodate the unique CoV-2 RBD receptor binding-ridge loop that more intimately contacts ACE2 compared to its SARS-CoV counterpart" sounds very much unsubstantiated. To draw these conclusiong, MD simulations might need to be not perfomed.

Clearly, the analysis of other mutations is also questionable.

I believe that the Nature article is involved in a  cover up.

Ashkenazi Jews and the Amish people are related and they carry a similar polymorphism not just on ACE2 but other genes.   Moreover,  Jews are less susceptible to respiratory disease. The paragraph below  is from the blog article with the title:  Bio-war race targeting (McCairn1).

Ethnic Targeting

A number of questions come to my mind. In the paper discussed by Kevin the Jews and the Amish have a similar genetic polymorphism that protects them from Covid.  This means that  the Amish and the Jews are related. The history of the Amish church began with a schism in Switzerland within a group of Swiss and Alsatian Mennonite Anabaptists in 1693 led by Jakob Ammann. Those who followed Ammann became known as Amish. … In the early 18th century, many Amish and Mennonites immigrated to Pennsylvania for a variety of reasons. Not only do the Amish share a polymorphism with Ashkenazi Jews that makes them resistant to covid they share genetic loci for myopia (Fine-mapping of candidate region in Amish and Ashkenazi families confirms linkage of refractive error to a QTL on 1p34-p36). Anabaptists and Jews have had interactions for several centuries, since the origins of Anabaptism in the Radical Reformation in early modern Europe. Due to the insularity of many Anabaptist and Jewish communities, Anabaptist–Jewish relations have historically been limited but there are notable examples of interactions between Anabaptists and Jews. Due to some similarities in dress, culture, and language, Amish and Mennonite communities in particular have often been compared and contrasted to Hasidic Jewish communities (Wikipedia).The Mennonite Metzler family, tracing their lineage of descent through Valentine Metzler, a German immigrant who arrived in Lancaster County with his father Jacob in 1738, has close Y-DNA matches to Jewish families such as Kronik (in Belarus), Cohen and Langer (in Ukraine) and Friedman and Wengrowski (in Poland). [Anabaptisthistorians].  So, that solves that mystery. At some stage Ashkenazi Jews and Annabaptists must have interbred in Europe.

Not just  the study cited by Kevin but this one also presents a similar finding:

Here, we have analyzed the genetic markers of the TMPRSS2 gene and the differences in their alternative allele frequencies (AFs) among populations to identify possible susceptibility loci to COVID-19 and to correlate them with disease epidemiology. *AF= alternative allele frequencies (AFs). Regarding the non-synonymous pathogenic variants, we observed the highest AF among the Ashkenazi Jewish (ASJ) population (Figure 1A), while the Finnish (FIN) showed the highest AF among European subpopulations (Figure S2A). 
Genetic Analysis of the Coronavirus SARS-CoV-2 Host Protease TMPRSS2 in Different Populations

And this article from 2009:

DENVER — Researchers at National Jewish Health and the University of Colorado Denver have discovered a gene that is associated with improved survival among patients with acute lung injury. Acute lung injury (ALI) is often caused by a respiratory infection and results in low oxygen levels in the blood, and fluid in the lungs. It is one of the most vexing problems for intensive care units, afflicting almost 200,000 people in the United States each year, and killing 40 percent of them. https://www.nationaljewish.org/about/news/press-releases/2009/acute-lung-injury

And this paper:

The K26R (rs4646116) variant is an ACE2 variant that facilitates the binding of the S-glycoprotein effective in binding the coronavirus to the host cell and increases the susceptibility to the virus. The K26R variant, which reduces virus binding to the ACE2 receptor, has been found to be more concentrated in the Jewish population (1.2%) and, in contrast, the Asian population has the lowest allele frequency for the single nucleotide variant encoding K26R*

* Al-Mulla F, Mohammad A, Madhoun AA, Haddad D, Ali H, Eaaswarkhanth M, et al. A comprehensive germline variant and expression analyses of ACE2, TMPRSS2 and SARS-CoV-2 activator FURIN genes from the Middle East: Combating SARS-CoV-2 with precision medicine. bioRxiv 2020
Effects of Human Genetic Factors (Ethnicity and Race) on Clinical Severity of SARS-CoV-2 (COVID-19)Journal of Experimental and Basic Medical Sciences 2020;1(3):147-158